GETWU ms CHARLOTEETOWN Gosknuuv mi. EBBJJARY 4. 193s =z v vwv wwvvw.v, g-.-'- Sociql " ‘AAA Assn‘ AAAAAA m: s*s.@-.1._.. ilflqli-fiiFask-i??? 7-" 11'7"? _-m¢n is _ Rssllm . rotliy 0a fills the Married Who Should Sue for Breach of Promise, Not Those Who Have Been Jilted, Sflys Dorothy Dix-For Sweet- i ‘ hearts Have Reward in Gooey 5:» Talk, But Husbands and " Wives Are Promised Hap- ”“ piness‘ That Never e Materializes a ‘lhewrongpeoplesuofowbreaoholpromise. Nomsnorwomanis ‘I to damages 591W!" l fickle girl or lwain has iOst his or her taste I once-adored individual and defaulted on s promise of marriage, A betrcthal should be looked upon as pie crust, sweet and brittle, easily broken and liable to accident, but nothing to so to law about if it happens to get smashed. Sweethearts have had their pay already. For it is better to have been engaged and Jilt- ed than never to have been engaged at 9,11, and love-making is in itself its own reward. Any youth or maiden who has feasted 0n the gooey eentimentalities of an engagement; who has experienced its chills and thrills and hec- w ‘rv-vnzr-r ,'~‘6¢fZ‘s . Garnet nnnhh alr l!‘ I wealth cl 80min sunshine PW‘ duecd u» quslirv um h- be" scaled fish: to: your sci-syn“ Y...“ p». can IuPPlY ww- oeuoirrFui-Youti. LIKE riAvol 11... rzousz WIFE and HER Acnwmzs ‘beefraidofdesthmsthouah yourlifewercbiroath. Decthbiltmints thooycswihh clay. Oh, surprise! Why should you he forlorn? 1m is the dean‘. of death-to breaths sway the breath, ‘Ibknowtmeendolstrifeatoieste tbs dceithleu lilo." EXTBAJDPCOATS 10 BE AMONG SPRING HEADLINEBS ‘llherohirnoifthecizstinne suit M‘ ofdrees .nd related coat to prominence has made the THE COOK'S i ‘r’ ' tic fevers; who has spent endless hours plau- ning a future that would be a Perpetual pet- ; . . , _ . ting party. has been paid for all the time and -. _‘ ' money that an engagement has cost. - Especially has any girl who has had the grand and glorious privilege of flashing her arrangement ring before the eyes of her rlnglese sisters had '. Xlfgreat momen that __pensates her for never having need for her ‘hope’ chest. The great tragedy of woman is not in the bridegroom failing It consists in there never having been a pros- soils, 1 “I l f to show up at the church. pective bridegroom. » - - Anyway, love is a gamble and- they are poor sports who whine when lacy lose out and want their money back, and who ask to have their wounded lings healed by a poultice of dough. w‘ The only people who are really entitled to sue for breach of promise ' pqgse husbands and wives who may. with some show of Justice, claim that they have been deceived and injured by the ante nuptial promises of flak spouses on which they failed to make good. I ' Most . for instance, might accuse their wives of inveigling hgjhem into marriage by means of false and misleading propaganda and by auhaudulent misrepresentations of the goods they were ofiering_ Many a Wman might claim that he thought he was getting Miss America, to he fklhalm to his eyes, when he took unto himself a wife, but that he found I!‘ _ _ alter the knot was tied that she got her complexion at me drug store . “(mid her golden loch: at the beauty shop and her chic air from her dress- _ tbjtpaker, and that instead of being s. living picture she was a chroma. ”l_‘ ‘" _ 0r a. man might say that the reason he married the woman he did was w-because of her domesticity. She was e. home girl and mammirs little " _lpo_r. Her favorite literature was the cookbook. lo brother and sister that he had difficulty in shoving them away lung p‘ $101811 l0 PWPOIQ w l1"- WIIBB he called she fed him on savory dishes -~ flat she alleged she prepared with her own fair hands, l. __ I So he married her expecting to get an industrious, thrifty wife, and ' ‘to have a large family, and. to feast upon angels’ food. But it transpired ‘ I.) first all of this was a more come-on-that she hated home and loved the - . ets; that she regarded children as brats; that she loathed pots and tcpnaandthmwhenshsmarrledshecamaoutofthekitchenforgood ‘ _ l‘ bd never wem book into it. W, 0r a man mlwt say that what attracted him to his wife was her , I nmiahility and adaptability. Before marriage butter wouldn't melt in her _ ~ “gpputla. There was honey on her tongue and all that she wanted in life “was lust to please him. Her vocabulary practically consisted of "just as u lie, dear," hilt halos. the honeymoon was over she was the family and he was jilnping whenever she told him where to get on off. All the sweet talk had turned to pickled tongue. say that he married under the firm belief that he whose applause he would always he sure_ Some an creole,‘ one who considered him a wit and a oomd liden forever, one whose chief amusement incense at his feet. ntanieee he found he had a wife who corrected his grammar , who meerod at his opinions, who yawned in the beflstcflesandwhofliwlrentlyrcgardedhimassmuscum sf; i! "pi migbtsueherhusbandforbreachotprcmisebe- me vows he made when he was courting her. Many husband: “Before marriage you promised me that e would never grow cold and indifferent and you would never take lo for as I know, you haven't noticed me or how I looked Iyouwoeldgivemsskiesthstwesnitjirste. I would fall deed with surprise." new to her husband: "You swore to endow me with yet I have to panhandle you for the market money 1' L‘? Does the Hard Winter l? Sap Your Vitality? V‘ i : Do You Find Yourself ’ Week, Drsggy, Pepless .7 BLOOD test would probably show that your predo vlisiiz- lng and dingy-producing haemoglo- . < bin has bee: thinned down until it is . 1‘ from 10% to 25% or more below nor- ' msl. Tossibiy the effects of winter ills have also lowered your blood count. This condition, ommon in Winter thin-blooded people held in a largo __'; 5nd Spring, can be econ innds right Canadian dty. I . j l What Blood Tab '“ OF llO People Showed These 40 men and women were. fiver: the blood-enriching and revitalizing‘ powers o! this “arid-famous remedy. Every patient whose blood count was below normal had it materially h. s; h. z by treatment with s remedy that is prepared to ' haemoglobin and to- build up the blood count. Such s remedy is Dr. Williams’ Pink Pills, which was thoroughly tested st s clinic of 40 run-dawn, below-par, t ,.d_,!w haul“ h, “mm creased-positive proof of the power c, “I ‘you, of gm, w], d, 1195 h m, of Dr. Williams Pink Pl": to aid in i-{i- mpqicd-poduvsprooict forming newrcdblcodcells. A _ A This Authoritative Toot ' Proves the Value o? This Remedy l“ Fcrlncreaeing Strength and Energy elihbiflktd sndbsves time. Thsylgeh nelmvhdns ksvw what ha?» to nloy health. You can just as surely banish your me oi chronic fatigue-just u surely minim your blood with new red celh esd crutch it with deity-Pre- duflg haemoglobin-by s low weeks, Dr. William’ Pink Plib (so csilid because coated with pink qr). Your druldet he this clhde- ally-tested remedy-Jo rests a "QQ; ll" She was so fond of beef CORNER BUTTERSCOTCH COOKIES, 3 cups sifted flour 1 teaspoon soda 2 teaspons crea mof tartar 1-3 teaspooon salt ‘A cup butter or shortening 1&1 cups brown sugar 2 eggs, well beaten ‘A: tablespoon vanilla Sift flour once, measure then add soda, salt and cream_of tartar; sift again. Cream butter and add sugar gradually. Then cream the two to- gether thoroughly. Add eggs and heat well. Add vanilla and flour mixture, mixing well_ The mixture should be a rather soft dough. Chill until firm enough to handle. Shape into round or square loaf, wrap in waxed paper and chill overnight. HORSERADISH SAUCE BROWN AS RAVY If you want to give your next roast of beef Just a little different setting-oil. serve this brown sauce —macle piquant by the addition of horseradish-instead of the usual brown gravy. lt is quite perfect with 2 tablespoons butter 2 tablespoons flour 1% cups water or stock 1 teaspoon, sugar 2 tablespoons grated horse radish 1 tablespoon vinegar 1-6 teaspoon salt Melt butter in a saucepan snd blend in the flour. Brown while stirring constantly and stir in slowly the water or stock. Stir and heat to boll. Simmer for three minutes after reaching boiling point and add horse radish, vinegar, guggr a.nd salt Just before serving. servants." ing. If the housewife goes over the - is easily removed. ‘ and you never give me e cent for myself, although 1 do the work o: four Mimi’ a Wife might say to her husband: “You promised me that you would be faithful to me and that I would always be the only woman m your life, but what about that pretty blonde stenogrspher of yours?" Mull’ I ""9 1108M lily t0 hor-husba ’: "Before we were married you illi-mlled 0n my doorstep and could never get enough of my society and l_ married you for companionship, hilt now you are out and 8011c as soon as dinner is cver- and I spend my eVenlngg plane," 0h. plenty of husbands and wives be [pod grounds breach-of- Pmmlle suit against those to whom theyvir-c married. M . alert coat iesigner think in terms of what one might call "the on- semble coat” But this we mean the type oi’ coat that s woman has fouodasitopcoa-tfrarasuitbrae a companion of the printed dres- a loose comfortable coat that has a 101189! life than that oi’ the fitted and sometimes fur-trimmed spring coat. ‘Iheee coats am dressed hp he- yond the point of Just being iden- tified as a swagger coat in navy or black. They are made in porous wooliens that reveal a glimpse of the white lining or the glisten of taififeta; they do tricks in seaming and pleats at the back: they make the most of the inspiration f French designers in using quilting ajmir work, embossed patterns, fringe. SIIVIPLE SUBS SOLUTION CLIANS WALLS EASILY To clean kitchen walls and wrcd- - work thinly coated by grease from stove fumes, use agallon of warirn soap suds to which a table- spoon of kerosene has been added. Wash a small space at a time and then rinse with warm water and wipe dry at once. A sponge or soft cloth is suggested u. use for wash- ing and a soft lintless cloth for wip- kitchen onoe a. month in this way. she will save much time, as the dirt NURSERY DIET THEORY DISAP- PROVE!) when the time cclnes for '1 young baby to attempt a more varied diet than milk a very oom- mon first Qhange is to give "bone ‘and vegetable broth." At many welfare centres, writes an English newspaper correspond- d 1n many text-books on the $211M d children there u s standard premript-wuwtlmnl u" . or r n ‘ bones in water to which vinegar has been sq- ded. for any time WWW 1°“ “d mm mun-s, with the addition 0- Wmm; vegetables for the lalt 1W"!- such s oomootion has I I!“ N‘ putetlon as a source of minerals (lime and iron) and of valuable Pm‘ win; but recent experiments at King-c Oollege Hospital. reported 111 the current issue of the "Afulllvfl of Disease in childhood." Mm l‘ indicate that 3B1! brow really pcssesee fails far short d: what is commonly beliced. Bones he l been boiled for vary- mg lengths of time, with and with- out the addition of vineswr to the water, and chemical dialysis M! been carried out on m1 Prflluii" B5 well u on the reailin of soakin! bones in cold water and of similar experiments with a. choice o! V08? tables and with bones and V889‘ tables weather- Ithfoundth-attholomesctflli! upper-taut minerals (ie. m!" m‘ bones to the broth) are more or l: 9 complete at the end of 0H6 11W! and am very much the same whethegr the WB/iflfllfl "Bed u’ “wk the bones st the ordiufl-l‘! Wmmm‘ mm r if ~ laboratory or allowed to simmer at boilind’ P01"? vacuums: CONSTITUENTS With vegetables there is a differ- ence in that cocking is essential W obtain the required constituents. This is because the vegetable 0611B are still alive and resist the action. of cold water. One hour's bouine is quite $111’- flciem to get the necessary Sub- stances extracted, however. Only» one products appears t0 b0 obtained from bones in increesim quantities if the boiiingh 110mm i1 r01 ed beyond one our. l Fhatmlgis the nitrogen-containing protein It is explained, however, that the type of protein obtained from bone: 15 a very poor quality (mostly gela- tinc and very inferior to that sup- plied in milk, Imieed compared with milk, the “bane and vegetable broth," intended as a "$101189? article in a mixed diet, appears t4: be a. poor product. Nevertheless it has the advantcefl of introducing a varied taste to the young infant's palate and. 801301111116 to the present researches, the recipe for broth should now advise soak: Lug bones in cold water for severa- hours, adding the ‘K800831159 u” boiling for one hour. The scientist: appear to have shattered a WWW nursery belief. ARTISTIC WINDOW CURTAINS Glam curtains are Just ss im- portant in the well dressed room as overdrnperies. True they are not always necessary. but when y“! 11° decide to'use them be sure to get their length right and to choose materials that will he appropriate b0 mg mngmgs that accompany them. If you have a beautiful view from your livLng or dining room window “my m“ m. Dimense with curtains entirely in sudh a case, or use one ct the vista typo that miw be DORUIBYDIX. drawn back by en invisible cord so Royalty Off To Holiday In Munich AMorningSmilc hole." . Mrs. Dulehsni was always com- becauee she could not 11nd any new topics of conversation. “Why don't you read hooks?" her friends advised her. “What kind of books?" asked Mrs. sham. Dul “Oh, biographies and histories and so on!" replied her friend. The fruits of this advice were ev- ident a few days later when a visi- tor called on Mrs. Duleham. "Wasn't it very sad." the latter gravely remarked. "about poor Mary Queen o! Boots?" that your vision is not blocked Then, at the wifiihwihhamdrapet- ies that extend fmm the pole 0r rod to the floor, or within an inch of it. And keep them poised well back, so tho/t they merely Home the view. ' Another instance where glas- curtains are needles is when Venetian blinds an employed. These take their piece and your setting is “ with e. pair of d. peries at each window. When hanging am used the cor- rect length for the glass curtains is level with the window sill. If they hang outside the casement or window frame (and this is seldoir the case) they may extend to the loweredgeof flieitreme. _ In rooms done in modem iiunii- ture the glass curtains, usually oi’ some rich, silky, dieplmnous matwiel, may reach right to the floor, even when draperies are used. But again, um is not the ordinarything Neversklmp onthe material whenhuyingithy theyardand makingyourownmirtains. Allow amplcsobhscyoucsnsbir-r it genercuslyon therod. Nothing loolnemommidethan suurtein the/thastobepulledtighttomake it extend scrum its half at the window. A few ago the stores sold an 1y fine net for glam curtains- Ono saw inurdly any- tbingeloaButnowthewidci-the mesh the better. m pendulum has swung the other way. Even msdclooktotheopenmeshednet curba/insthatmakethem highly desirable. while if you prefer r AAI ti... com rumors . “NICK! VA-rnc-noi. Atthbiintwcrningnemnfl- neel or nlel Irritation, l... apply Vich Vs-tio-nel-iii s few dlwlwuldiaoetrillisflmebme - flan? N51 C 9P8 4!\ nu n c sriuns lGrandn-ioihcr’: Quilt Ifdyfterne and are harubume little dogs, with beautiful coats and finely-shaped hunting eetelbliane-nt. "Va/Ii so) "1 ~\ \ Cut out appliqurz pieces and sew ls indicated on small block. Arrangi pieced and applique blot ls lllii gelled on quilt di Iflli edgi of quilt with e binder. Allow for ell seams when pattern. Block finishes i4 inches square. 20 ewllqm . l0 plain When ordering give fl-‘I- Bendlbcforabookofq tpot- Lerns containing 'I beautiful Grand- mothc quilt designs - every pot- tem different. ll0W’S YWR i. . BL000 ? OU lose vital nerve force if SHORTEE HOURS IOI AUUIIAIJA A mMonal invests-motion by e special Australian tribunal into working , and that 10,000 CHILDREN Al‘ SOLIIN HAS!‘ lhthebeautycledmitllmlim attend 5 § diiiig i i "2 a5‘ t? agsi §§§ precious liffls model whme smart simplicity mshes it emedslly lovely for sweet young things for lsssroom The miin dress is exceedingly simple-e little moulded bodice and shaped skirt. s mode which with but slight v rations bu survived through the ages. The modish nod- line, however, links this model def- initely with the new-season. Velveteen, novelty reyons‘ that W100i, liahtweiflit twoeds, ROI. WW1! NWO lllk. 000-. are 1am attractive suggestions for this l. 0 Style No. I10 is designed for shes Price of FAITH-N, ll 0GB ii stumps or coin (coin is profound). Wrap coin csrefulk. Ne. 070.0 else .................‘.... ...-su-........ ioociocleetsnnsee one I O _ chaotic“ " -' isaeaoeslbilllllxili isllollllslossclullllllllfiilsastees RIKIKINTHIRI fines-weave ngnssamer netso mqgqnqyuynncqmugmgnh. shaortlhattlw ‘ .“ em- tm‘ “ cnr*+ ‘lcee- ysumschmmtofiioi“ bodiedlnithlwrdiymmwuneuwmureymcomwestmgiu- 1,2,, 0mm; lovely ” ‘ is le- ‘M4 bum than the little mommies newou’; and m,” ourtelnisinendedfortheboudoir mgmqmqy-m-orucmrcgmtdin- downandinmed M‘ bedlwm- telligenoe emphasises the libe- of ‘ blood tom-c ncsofthe Oozgistotim ians _'1_,,n yuur“ N0 eTAnLls zzrsemercst ears 004:1? mus- 153111;.“ again]; ‘mereportiliettho nun-cor _ I “.1 our"! 3mg w“; “my; ghqmflngdo“ iired-ciflandweshollowosdvicsci establishment at Market Ilar- 155mm fin"; age-peg; I:;,B=';g;,S§;,§~;-,; bvwush. met with a Prompt deulll If most that you are stewing or veryn1i00r'coridiiion and I out was m“ from his controller (says the Beer.) w”; “m. mg,’ “g4 pubic- “ “lum- Plelffalflvlw Madlbhod “S; Thilllmiflfwi I'll W“! moondvinepr tothe water. iilmmmrm Pam“ koenneesforlsimtingcfhhbrotiragqgvq-gpawnnettorunsliwrap- l vinsihwsinsu Pm!“ "f “*1 min new. Is the weer 1mm "‘\t§i.."i§'..'i=‘i'=§€=°t“ci§1t',"§' 31c, mHehalnxjriahbilnmmdtghfllflywlldlgmngqfflygjulogg. Icrfroemediaisdvioe. _' " E on 9% OOW¢SIODB he draws his mount from the Anny SMART FROCKS FOR FASHIONABLE PEOPLE Illustrated Dreeemaking Lessons Furnished With Each Pattern