O mil- a l‘i'liil"‘iuliili~iih~dliilli.ildiliitiilisiiiltghel" - "n. iiiill Mlllililliiii’ nu us: Ziiii " Then ALL-BEAN Brought Welcome Belle! ma us. vol ietter s... Hr. Lecour: “I have ‘troubled with conlstitpiagou‘ 12a the past “i: years. pre calb ev cathartic without results, “Recently, I determined to give Kellogg's ALL-Basil a fair trial. Kello 's ALL-BEAN has not only hel me, but I believe it is an actual relief for chronic constipa- tioni-Mr. Henry E. Lecour. d- dress upon request. ‘Duo to insuflicisnt “buik" in meals. _ Kellogg’ s ALL-BEAN provides “bulk” to aid elimination. It also furnishes vitamin B and iron. The "bulk" in ALL-BEAN is gen- tle-and safe for normal individ- uals. Often more effective than "bulk” in fruits and vegetables, as it does not break down within the body. Isn’t this natural food pleasanter I than patent medicines? Just eat two tablespoonfuls daily. Chronic cases, with each meal. If not re- lieved, see your doctor. Get the red-and-green package at your grocer’s. Made by Kellogg in London, Ontario. Keep on the Sunny Side of Life l l lilrti? i Professional Bards _ McLEOD &‘ BENTLEY W. E. BENTLEY, K. C. J. A. BENTLEY, K. C. Barristers and Aitorneys-at-Lau MONEY T0 LOAN Office: 180 nlchmand Street. 2:, Vii ._ Prohibition Commission Chas. H. Black, Chairman. Charlottetown Ias. B. McDonald, West St. Peters. John Simpson. Hamilton. Send all information regarding Infractions of PBOHEBITION AC1‘ to the above or to inspector I. Fripps, B. C- M. P. Charlottetown 5n NORMAN W. LOWTHER Banister & Attorney At Law 86 Great George Street Charlottetown, P. ll. l. MONEY T0 LOAN Alex. W. Matheson BAB-RISTEB, SOIJOITOB, ETC. Money to Loan Collections Oflice: 140 Richmond Street. TENDEKS Tenders will be received at the office of htleergelai-rllsvatehelt ed also that Barbara Drew come a duchess and that chapter oi his liie had closed. He still had kept his rooms at Mrs. Gray's. His nervous restless- ness alarmed her and Peggy, but in his rooms he was sorting and col- lecting the receipts and records o! his expenditures to show Swearen- gen Jones. He had the accounts bal- anced up to the hour. Convinced that his record was perfect, he came down stairs and sought Peggy. "I'm a pauper. Peggy." he said. “Is it all gone?" she whispered, "This is the residue oi my estate," he answeie’, showing the few dol- lars he had obtained from the sale of much o! his wardrobe to an old- clothea man. “I know you think, as the rest do, that I have been a fool. I'm going to begin life all over again. It will be a new Monty that starts out, but it will also be the old Monty." “The old Monty?" she murmured. “It would be better than the Monty of the past year." "And in spite of all, you'll stand by me, Peggy?" he asked. "How can you ask?" she partied. "Do you care enough to start all over with me?" he went on. "Peggy, I want you. You do love me! I can see it in your eyes!" “How long have you been realiz- ing it!" she said as she stretched out her nrms to him. XVII. It was difficult to get Bragdon and Gardner to agree with Monty's plan to marry Peggy the next day. They declared it unfair to her- that he had squandered his fortune. "Peggy is too good a girl," Brag- don declared. “It's all arranged," Monty insist- ed, “You fellows will have to lend me the money to pay for the license and the clergyman." The wedding took place at the Gray's home. To Mrs. DeMllle fell the honor of helping Peggy to dress. "The , “' ‘ girl in the city" ex- claimed DeMille as Peggy appeared. “And look at Monty! He's becom a new man," said Bragdon. The ceremony, brief and simple, ended just as a ring at the door sounded. ' ' the City Clerk up to noon on lfriday, April dtli next for supplying the City with Motor Pohce Patrol. tender. The lowest or any tender not necessarily I accepted. GEO P. NICHOLSON, 1'Z%H?—§'Z-I§fi.=§"l-L'%'Z€ g Ii i}: i 3% l‘; i L-ssii-a-sc-zi. Specifications to be supplied with City Clerk. our‘ Sons" in "Hopper" entered. - But Harrison's chief aiin was to convey a letter to Monty. "I ain here so is the inonq,” it read. “You've had a to"!!! and have bem ‘pann ‘" by one, but no wit’s your own You'll iind about seven million lsrs‘ worth of stuii to your when you the certified endorse tschceksdcwnatflrantdaltiplsye. myboynltsalihere amt inflie the same figure. I it. Hope you'll forgive the whims of an. old man who has liked you from the start-Swearenger Jones. ‘THE END. Seek Owner Of Unclaimed Bank Account (A. P. By Guardian's Speclll Wire) BOSTON, March 27-Hakon An- dersson, a seaman from Gothen- burg, Sweden, was the object, of an international search today after an unclaimed bank account now worth $530 turned li'p here. Emil 0. J. Dariielson, vice consul oi Sweden at Boston, Joined the search for the seaman who 90 years ago deposited $216 in an East Bos- ton bank and then turned the bank book over to Anton B. Morionsen, superintendent oi the Norwegian seamans mission here. The account gathered interest and the bank book was discontinued recently. _ Mortensen, who left the service of the mislon shortly after the in- cident in Nov., i914, recalled today Anderssoifs instructions to “mind it a. while." Unless Andersson or his heirs are located immediately the funds will be “outlawed" and turned over to the State of Mass- nchusetts. Drydocking Of Ships In U. S. To Be Probed (C. P. By Guardian's Special Wire) OITAWA, March 2'l—The Dom- inion has ordered an investigation to determine why two ships of the - \ government merchant marine flee-t are being repaired in United. States drvdoclcs, Minister of Railways R. J. Manion announced today in the House oi Commons. At the same time orders were issued all ships Cl-lARLUiTGlAN YOU KNOW well enough what you want your new car to have. Speed that whisks you sway at the flash of green, unlimited power under your control. Economy that cuts your monthly bills to the bone. A relaxed ride at any speed on any road for front and back seat passengers. Swift, sweeping body contours that glailden your eye; fabrics that speak of luxury. In a word,.you wont u high-priced cm- for as little us you need pay -— the New Ford V-8. This is the finest, most economical Ford ever built. It is 19.35% bal- anced car—because it combines qualities of performance, comfort, de luxe appointments within and \-. 1,1 foot and hand. it is possible to have portant refinements. without. The‘ most important fea- ture of all, of course, is the brilliant a Ford V-8 engineJ-iinproved and refined to a point of performance that will genuinely thrill you when you feel its brisk response to your 1,400,000 owners have tested this engine in millions of miles of ser- vice. They know from experience that. V-B performance and still he thrifty. This history-making engine, which brought new performance standards to the low-price field, has been made, still finer, still more durable, smooth and qulet—by the addition of im- You can easily convince yourself that this pace-maker in performance now leads in comfort too. Pcrforni§iic%e-Coiiifort and Economy- malieitliis 1v... Foril an... nannwi C... No obligation. IIAVE A DEMIDNSTIATIQN Your nearest FORD dealer will he vcy glad to give you a drive-yourself demon- stration in the New FORD v-B for 1935. the thrills oi Thursday cooling If Columbia System. TUNE IN n.- roim suimsr lvamno IIOUI. Symphony Drellutn and celebrated pa! “an... o o'clock em..- SIIIJOIJ Tine. case-u- 51...... rnrn WAIiING AND msrannsnvsinsss. $ I 3 z puyneat now bun u Ford V-l. Sea the nearest denier for details. ‘swarm-arr 11111.? snatches" _an.-o l 9e30, Intern Jiqdard Tine, NEW REDUCED PRICES I Irene! o] compactness and simplicity. "in lord mouth and a reasonable down Inir-eyi V-U Illlle ghee visit-cylinder per/announce with iadw economy. You comics hay my other car in Canada lellll a V-I iyps Quins under Q5300. $65711 in the future must be my in Canada. he ma. , The two ships are the Canadian Highlander and Canadian British- er. The Minister anounced a ielw days ago it was impossible to oh- tain drydooks at Halifax and Saint John at appropriate days and the ships went to New York. The Railway Minister. questioned, TENDERS , 0- centrifugal pump per square inch. at delivery end for iiiiiliiPizl ~. b5598-3-25-27-29 {Ofiikltkiziilkticflétleev .. driven by hose to draw water from river or pond. Imperial or 1500 American gals. The lowest or any tender not necesarily accepted. Tenders will be received at the office of the City Clerk up to noon on Friday, April 5th next for supplying the .- City withone combined Street Flusher and Sprinkler with separate motor, capable of 1 delivering at least 500 gals per minute at 100 lbs, pressure Should be provided with standard fire hose attachment flushing man-holes and with suction Tank capacity 1250 G. P, NICHOLSON, City Clerk. Nogcn z i Ilse Illnuni‘: for Burns \ BRINGING UP FATHER by Hon. Peter Veniot, former post- mwer general. said today his ear- lier announcement, based on infor- mation received from C. P. Filller- tonodtheqrtlltwasinaocurwto in ‘part. Inquiry was made at the Saint John drydock, he said, but not at Halifax. To clear the air an invwtigation of the whole thing had been ord- ered, he said. Soint“ John _ Police Hold _ Kidnap Suspects (CI. By Guardian's Speck! Wire) SAINT JOHN», N. 3.. Mitmh 21- Royal Canadian Mounted Police here received word tonight that two officers had left Toronto today ior Saint John following the arrest here oi two men who gave their names as Kenneth and Rand Pearce. suspwiod of being George and Riowrt Prince, “ ‘ ’ on charges of armed robbery and kidnapping near Portland. Ont. last October. Another brother, Albert, and Howard Buibridge are serving sent- ences in Kingston penitentiary for the same oifences, involving the hold up and robbery of a tobacco truck. The kidnapping charging arose from time gang's action in locking the driver and a compan- ion in the truck. ‘_ An Ontario provincial police cir- cular bearing pictures oi the two ‘wanted men led to the double ar- rest early today. Police claimed de- scriptions oi the men held tallied ,with those of the brothers sought. one was arrested in a restaurant and the other at his rooming house. Na rco tic s Smuggled In Periodicals (A. P. By Guardian's Special wire) , . 2'! lment od nmcotim in magazines and other periodicals was described by federal oiiloials in Boston today as the ‘latest ruse cd an international oom- bine which smuggles narcotics worth millions of dollars into the United States annually. Andher method o! smuggling, in- vestbatois revealed, has been to throw overboard from incoming ships in Boston harbor waitin- tight ‘ nascoticswiiich loterwerepickedirpbyfastinotor ciultt. Bronx Honors Dr. J.F. Condon (C. P. by Guardian's Special Wire) NEW YORK. March ki-Dr. John F. Oimdon, the "Jaisie" who paid over the Lindbergh i- hss been unanimously voted an r . m; ' ...~.-... 1n m, Bronx Chamber oi Commerce "ior service he has rendered to our great borough," the chamber dis- closed today. Oondon testifying two months alo at the trial of Bruno Richard Hsuptmann for the murder o! the Lindbergh baby, was asked where he lived. "I was born in and have always lived in the most beautiful ‘bor- oughcf the world-the Bronx," he replied. KIILED PLAYING 0N ‘ROOF BOMBAY-KL?) —A three-year- old Hindu girl was killed falling from the roog of her home where she was playing tll with other children. BIRihIINGil-IAM. Alta. March 2'! —The advance of spring yesterday brought strange terror to 12-year- old Mary Kate Wane, who leads a weird Jekyll-Mr l-kvde" exist- ence in real llie. Each year, as buds open and flowers bloom, s. mysterious malady temporarily trai-isionns the laugh- ing, plump little girl into a shrunk- en witch-like creature Yesterday, Just as Stevenson's famous fiction character entered the body of Mn Hyde. Mary's “Dr. Jekyll" was slowly changing her small body gain. Dootpra fear his visit may permsnen. Children fingers am once more curling into talons, and her back is becoming hunched. Chubby fea- tures are thliming into cruel lines as he: head shriiflis into her shoul- ders. Oneiootdragsasthede- formed child shumes along hospital corridors. Doctors U! tely blflbd W the defoimity. Mary's mother said more than M0 of them have failed CANCER The number of deaths reported as being caused by cancer is becoming greater each year. It is becoming increasingly obvious that new methods of treatment must be developed in order to cope with the problem. Activity in the field of cancer research is being increased throughout the world. Reseaich has been nude possible through cancer funds which have been contributed. in large measure. by the general public assisted by Governments. Such however, are not used solely for the purpose ci’ research, but to improve existing methods ed treatment. euieciaiiy in Iflilllfi maintainers. m ¢ Mysterious “Jekyll-Hyde " Malady Attacks Girl, I2 to diagnose the child's trouble. Mary, the mother said, was a normal, lovefole little girl until she was three, when the nrst attack came. As summer arrived, however. her health return i and she rorr / l and played with other childre... For nine years, the visits have continued. Sometimes Mary has lostmone thanilopounds in the spring. She would regain the weight and coiitliue to grow nor- mally. She mashed the fifth grade in school with an average scholas- ilr T“""0l‘d. " “ W1":- mi/i her daughter complained c1 no pain un- til last year, when the amiotion ivas accompanied by severe headaches and pains in her arnns and shoul- ders. "rhey hurt," she himpeied to her mother one night as a. new at- tack came. The deformity did not completely disappear as usual that year and doctors last night believed the gradual return of “Dr. Jekyll" may mean ent sorrow to Mary Kate this time. chemist, the bacterlologist. the pathologist and the physicist - and statistician are correlated in an ef- fort to ascertain the cause and .rnew ‘L; d; . . The day is rapidly passing when an individual working alone in his laboratory can make a discovery of rrlaior impo mice... No disease has presented greater difficulties to the investigator than has cancer. Nevertheless. we are to- day able to grow cancer cells on glass as we do bacicria and study od- radiant energy of liioratim are being published flnoughout the world aettinc forth tbs results o! emerluwnts. The tabulation oi this malarial alone an eccrmcia task. It is extremely diffioultfoi-snyoaeimiiviiiuaitc keep in touch withtlse experimental work that is being done in. the cancer field. The imoortaru-o oi cancer as a. cause of death can ac longer be ignored, The challenge that it pm- sents the medical profaslon oi the world must be met, but little pro- gress can be made union are available. In mite o! the high mortality. the treatment and cure of exicmal cancer offer little dif- ficulty if treatment can be begun at a sufficiently early time. Internal cancer offers considerable diffi- culty in and dbgnoeis can be made. as a rule, only by competent authorities who surrounded with every the increased, so must the facilities ior the treatment of cancer augmentedlnthiswayonlyceiiwe succeed in controlling this disease, which has taken such an unduly lei-gt toll oi life. It ishoped the King V. Silver Jubilee Cbncer Fund will be a success. The fund will be sdininistored by trustees who will seetliot itisputtothebutpos- sibie use. Please do not forget to send your dcllsrto LadyBessborougnGovern- merit House, Ottawa, who will scknowledgeitwithapelaonalcaid their“ vicurtotbeinilueneeoi Hendoulaptist Their who was one oi the bridecmaids said she felt "quite stunned." called it I day and left. INDIANS TALK UNITY DELHI-ELF.) —-Considerable in terest has been aroused by new un- ity discussions between the Muslinu and the Congress Party with sug- gestions of coalition or co-operzition _._________ BOMBAY-(C.P.)—Authorlties in Junagadh state have discovered nn extraordinary forgery involving i whole collection oi carved writing purporting to be Asokan rock edicts a An Important - Duty For Parents Really modern parents take no chances with ao imoorlll" a matter as the vision of their children. because they luiow that neglect in this respect is extremely unwise and may be harmful. Neither do they wait for a child to complain oi the way he sees. The! h"? their eyes attcuded to before THAT. Be a modern parent- G. F. Hutcheson OPTOMETRIST I" rfésio n i" i-zxiuininon Ilttilllllllllbillflllallfi- .ete. ll. J. IIABOII OPTCMITBIBT Ollee Connected With Drugstore ____ _ ___¢. . - ~ '- GEO MANUS " V‘ The money obtained from the King George V Silver BY - RGE MC Jubilee Cancer Fund will be used for the purpose of cancer ' . » ' prevention and control in Canada. It is essential that everyone in Canada should enter into the fight against cancer, and necessary therefore that every individual who can should contribute. ' ’ ~ Beasborough, ~ Kindly send your contribution to Lady : fflio will acknowledge it by means cfa cord bearing the _' - ctograpls of Their Majeaties, the King and Queen, 0R‘ yocprefer, you can send your contribution to the Chief tlpflfller, Department of Public Health, Charlotte- will forward yeareoiitributions, and acknow- will be seat direct to you from Lady e7, little wil _ l H‘ ill A ll l. l-l , l liilllllll libs accomplished. imp tlilvietins. _ h a ‘i Q _ .