race r0111: ” l l governments iii Britain and in the Doiniiiions. _ he Empire proved that its institutions are flex- ible enough to cope with the unforeseen. “What is equally impressive is the practical 111s CHARLOTTETOWN GUARDIAN Notes BwThe Way l ‘PUBLIC FORUM illocolqnlaopulllfii President, LIcnh-Col. W. Cheater I. lcLnn Vice-President, J. B. Burnett, l‘. J. l. Young people who see the more 44th A 1' ry l sum." Holmium 0' L Human,“ 0' ‘i 0' manner in which the British peoples faced a 3511311012141 conditionls munder whaifih w‘ " “m” '8" "-1-: 3 . , . . . . ' ' , d l l Iona no! _ = 1 ‘w11==="=»-a~@=-=»=1==r1w :‘,;':g&:.t?."‘f»1' t“ iiiatip-ail-raiiiir .=*--- 1893-1937 i-~~—~ — ‘ , iey w 0 , 0n gen mien a ¢)n- uncouth!!!- lllrnlnl Daily (hluniled issn um b" 1w (111 “"1"” l M “ml m” l“ ll l‘ km“ l“ “me sideratioiis, [ierinit ai1y action that would of- fend millions of the Crown's subjects and there- by weaken the imperial links and JCOPZIFdlZC the Slflwillrc 0n which their livelihood and even their lives depend. “Iii George VI they have a King suited to their necessities. His father took the throne four years before the first World War. The son knows that he may haveashorter period to pre- pare himself for the strain of Kingship during war." . sections. Many rural dwellings are Is up to date and as comfortable as any city home, but many are still what the young folk dub _ “rural slums." It is easy to see their point of view and we wish them luck in their right to obtain the comforts and decencies of life. —Kitchener Record. ' delivered in City. $4.00 par your (in ulna-nu) mailed to Prince Edward Island. “.00 im- rm i111 14111111") lulled t» Canisdn and united 51am Tucson, JANUARY. s. ma: SPLIT LOG WANTED Q,—During the past month our clay roads have been in an intol- 55 REAL 55 ORGANIC arable state; all cars and other flLMzNTs vehicles using such roads have suf- - _ ""1 fered much abuse, and drivers, in lasing“??? wétwggel glogisequence, have been heavy los- functional diseases and organic. ' . In fairness to justice and the ilvlgfgseaalg; “gins; ‘lgotlgeagil travelling public 1 beg our Govern- mncuonalfiimt a change m the, ment to provide measures that Wednesday January oth and following D ys 1' 3 BIRTHEAY. . . . a CAKES ‘ v Ionics wlbh". FUNCTIONAL AlLM-ENTS JUST A Footnote T0 History Saturday Night, a widely read _ Toronto pu1,li¢;ttiotl_ i. running a “weekly history of Canada", “Ibis liiglilv condensed summary oi ‘Event,- gn an [he t-hiei spheres of Czniluliair iii- tgrestyi 5a,, the ..,1,“,,-5_ "is proving increasing- It has been said thatthe Domin- ion's loss of wheat export business in 1930-35 was due mainly to European tariffs. Yet both Argen- might relieve, in part at least, tina and Australia gained ground as wheat exporters in these years. The tariffs are still there, but now Canada is catching up. It looks as if Canadian selling policy has at least as much to do with the volume of Canadian exports as European tarifts.-Winnipeg Free i 1v useful to our raiders, as is evidenced by the Editoria] Note, ' number of expre~>ioiis of zipprcciatioii wlucn l we are Ctill\'-l'illll_\‘ rccci\iiig." _ l Fm- [hQ \\'t'(‘l\' llec. 31-38 Prince Eduard ls- - land's solo contribution to the "history of Can- ada” is set infill as followifi: _.____. A \\'¢(‘l< 0f prayer bcgzin last evening. w =1: s May it be in Europe the darkest hour be- fore the (lawn of speed or ffll%Wh0l‘9BS if there were a murmur present it would be organic because one of the valves to! the heart was not closiiis 60111- pletely-allowing a little “leak' of bl . It was thought sufficient in those days, after examining the patient, peace has been reached. =1- a Press. such deplorable conditions.’ Corrective measures are surely I justifiable, and a fifty per centim- , provement wouldpfollow it only a little action were executed lat {the proper moment. Why cannot the Public Works Dept. authorize the use o1’ a split- Special prizes in all Departments m tell him that as his disease was only functional there was nothing; to do about it. nothing to worry‘ "P. E. I. ‘ Jails: Two davs after the occurrence. Premier Thane Cimiplnell, acting in his capacity as Al- log drag, heavy roller, etc.. on our roads when freezing has com- menced. and so render us some The iiiildness of the weather has deceived even _ , _ _ _ While visiting Russia recently, T. the gardens lflto thinking spring is here, Barron of London, ex-president of and Office torney Gcncrai, confirmed reports that a jail t * * M» pmwt ljhlwurd ‘Shmd-s 3,1431% r .\lr. \\'. Bruce CIllllICCk, son ‘of .\lr. \\'nltcr H. me; his wife_A Russmm She is ivas referred to in an zuldrcss by Professor If. .. liiigletloiv. Drzipers Professor of Aggriculture, better by what. spirit they could be llUll tioit-riiiizeiii, >.iiiird.i_v Night's comment is made right." p. K. Chesterton. 'Ci!t\'l'l-lll.i. tern Cziiiziilzi and lirilish tliliiiiiliizi. "lax collec- tions of lloininioii, yiroviiicizil ziiiil iiiiiiiiciiizal governniciils have shown substantial improve- month the number of insured per- sons in employment liar been ris- ing, until it has reached its high level mark in all British history- =i< =i= is Sir Gerald Campbell, British Consul General minimum of unemployment had ‘iritish Empire remain as been reached, he said they ma} l l year curling .\l:ircli 3i next is estiiiiaieil zit $100 the foundation of the l or thereabouts. The progress, Mr. Chamberlain added, 1's uniformly satifactory- Fredericton Gleaner. founzkilions,’but that we are trying to build al house that will shake with the (pialtes as do those of countries in which earthquakes are municipalities. i These three factors. >Zi'\‘.'\' the Fiiiimcizil Post. am hint],- cltjqlfifi upilll the horizon of lJLISlIICSS-l l l “Communivm? said Hon. Ernest r ti the National Federation of Build- 8mm’ and l° y’ 1mm and om i 1f n. is not appendicitis, gallstones, by some real or organic trouble. The paralysis of the hysterical patient the walls of the stomach and intes- t‘ne and cause a delay in digestion followed by digestive disturbances, ‘lack of appetite and constipation. that. these emotional disturbances with his doctor or a psychiatrist there would be few it any of the symptoms which are called "funct- iorial." real public service. Now the trade has undergone a . change. The runi-sellcr works un.. 080115, his amens loud and prolong- E . A modern rum-seller may be an -P.. an M.L.A., or one with a Sl-Tlllg of capitals attached to his blood" but yet gives orders to have The Lord is no respecter or pey- sons. juries, M.P.'s. M.L.A_ from punishment. r t 'L‘lil'l"(l lll Prince County Jail Christmas ' T d O ‘ ' - . . nlfgmlll up; P,.,,,,,,,., pmscnbed me Cum-e sy5< The front page views of y-esterdflyls papers lilriigglishmbreicldaygi-ratwliflhrilimspelitrti 5042a}, ailfféiljl: liviiiiagigfriliiillih: I am, s", itch (MLLBECK when Y0" are slloppmgjlt the 44th Anniversary tom of locks ll‘. the jail as "inadequate-Q, was anything but pacific and reassuring —\val', five) years in the land of the Hlfgigg 01,5516 ganglmdder ‘or appcml crapaud’ . . Sajem-gel a, coupon w|1h gvgry cash purchase I, p. NH], d h“, “Uppe- aw, [hm our Pi-t-iqiiqr (llsaslgrs and wddelkfkslll; ‘Iflufat W255i’ arlslifggflillldtx, o1- in stomach or intestines, he —-—-—-—--- ifllihdmakeTyou may win one 0f “N three illlwldlitil :1 .\l-»iiiri:il ziuiliciice of the historic ‘$125 a month. On the same job I wlmls w be ‘We of the Pam even RUMSTLLING’ OLD AND NEW‘ Ir ay ca 88' SIQlHlIFIlIlVF I . . . . . , __ . . , _ H“, h r I mm m“! ,1“. WW“. ,,,,,,,,,.,,,,,,',_V {or (Dahlia-ck, humiiierside,“ \\'|1o is 1n business at foreman and earns $250 a month." ilgssgflgéstonmch or cancer (if “ml Wllsfillill imlinwliimetliligiiicfiiilidllilglil l-[n addnwn to the cakes’ there l5 a sPeclal Drill? i~"'“'lil ll‘ l l "llllllilllll “lil-"l-lkll ll-ll ‘he “lrl "uivllll Eli-l" f“ .311 “ll-lunar (if the ~wcrkls "Even through the xlamor ofa Thus Drs. Benwlfd Fanlplls andiRum-sellers abounded. Rum was m each ‘lepalllllelll’ ymir coupon entitles you to stiici- of new llppii-iiioii. And now this un-l llllLIlUllIll." l” {f-‘lnlwillllir fox’ has ‘lust,’ m Christmas Eve and ailthismorningls S H‘ Kliallles’ Clllcilgo’ 11v’; dhihel l soul as "lellcllallmble goods in al- a“ oppmtl-mlly of wlmllllg one 9f these 3150- ,HHHHJH_ :ml‘_\_hlnd\v_ Much Hm Mllw m- Hly, Ihtlllltfhllliildwllll . r. fllilll .‘\ll(lL‘l‘sUl1,’lOCtii€(l m“, I new. d“, quite forge, we mlxiiltitilf‘ tihne a grasp-l: 31111:: Ieyzftiiyidsetoéte. There were open ton ha. wit. 'l llliiill as the outsuiiitliiig evr-iitl ml? n‘ “h, llllwhlllllllllg Chum m the 9mm’ thc Dtherjslde or the guild’ m? mo: ment ‘for those who suffer from-l Grain‘, "dens" 533,23? :22 Ingugtl-I IF YIOU ARE PAYING A BILL at the office a m. ‘l ‘vhhk Vflyk Ul- imlcpictlll Lmtrul ‘ulmilvi uiill ‘slhni-illg loinl topctwhrzites $193.35), gold ggfllieégghio 211i wgglrld rag? peace various synwpmms due m emotional “shanuesvn but me rum-genie)!‘ ‘as, ‘duplicate 0f your receipt Will b8 dIOPPGIl lll the l>llillliilil l iuiinlllg i1"? illllkr, Bu“? l)“ m“. UTA. mmt Phrases. but that they are 5112821?’ llllsglmenls “Fl, then in ill repute as he is, (or boyfiand you may Wm the sPeclal OffiCB Sun ‘:1- sum 33m“, (m, M, ‘Mm, an)“, iL si|h's_l assays. le is ntgittiating tor, the ‘(llfipObill ofnn bume ovepstawments o, Ch,.,5,,»an_ i “Functional disorders are jAuStLYo-i, ought to be) today. The Toms. Pfize- hyrvl“ m“ E m p my, “is hm a“ impwtiuuncc’ ‘lillllilll on‘ lfillfjwltkht‘ to the ;'\lllCllCéll'l bmeltilig jtyl perfecpy aware of an ma, de_ gizlertilljordpelgiieizsalBwitilfgilglefiurofi; aleps, ‘and Pats. and the Sally's, . 21ml an i - ii‘ ll lie ziiiyilliiig more than a ‘Juli’ mllllllllg (‘ll-v llllcll 31 lPIOQDQQQOQ- (Jooil gisstlilllfntlcylfilelllg: fllizlllllllYr-ngig 2:235 (nervblus) mmlifcstatjons Me notl seislegt aélfilurgfliiissgceigiil Seggiim ASli U18 clerk WlIO waits on you. ("lllilil-lll lll""“3'l" "l Wllilllll? ‘ll lll)" llelllfs’ llll‘l u“ w “m- , n ,,, come LrIJB. All over the uiorld or: Sllnply llmaglnlllg-l The pill“, that} illgfi. Even the children i?‘ iii; lii-coniiizsif’ .\~ .~.ii Iipologuc of the direction in T, 1 p]. 1 . . _ , matters that are desperately, wrong, P11? 11111311110115 Wmllml wmlllllllls °l‘ rum-seller seemed to know [the “high M‘, huwflncp h hunk“ umlur the Ljiunlr 1e ice ine of the ioi>e in English faimirig, yet today we have seen a little l5 Just us real as if it were caused, sugma attached to me trade. evening of old check our bearings. ‘ill bu‘; llll . _ _ _ _ _____ v t n or p‘ for prnbwms Unsolved lllfllllillml. C11I11l11'l(ll~’@- Pmfefior l5llgl9d°ll' Canada and anoiher for hliiiilaoyivitlh ‘as a true Paralysis due to a spinal! cmfitgfst is dlllgenl “l “lgllt- ‘l stated that in 1913 the number of horses used awhole lot of the kilted fraternity cord condition. These symptomsl Hyde gtegd-a modem Jekyl and ' ' for agricultiiri? lll England ivns 807,000. By 006111134118 iHWYIHf-‘dlflte P05310115 are not °llly real. l” the palm?“ crite lotptempelrgiéo bedan advo- The yez-r 1115;" l1:is conic :iroui1d. says the H,“ the nunfluq. had (lrflncd ,0 60-0w 1nd in the diplomatic service. Now they hurt 111111 mcflpacllalle 111m “me time a f H an at the Finziiicf: lli\~!_ ziinl (Fina-la is but little nearer phi, .8." i, “N, (ml, -0(ll T] /' b i f the dllllEhl/el” °f *1 590M511 Earl eve" m“? llllm who" were l5 l‘ iinn iwmes bogfgsg“; of rum to _ _ . _ . . _ _. v v ‘ . .‘ _'~ l ‘ 1- __\ I} l-O0Q_ I l‘? lllllll cl‘ 0 shares the British Throne. so that real organic cause. bemuse of his __ y" i n 501115- l" <1 "llllllfl ‘ll ll> lll-l.l"l llmlllllll‘ lll lllllll“ llllf lziriu tractors sold Ill (Jrerit Britain had iiicreas- the descendants ct‘ the heather Stu] mental attitude toward his trouble." The blg male?" rum-Seller 311cc than n “ 11s when the curtain row nil 103th pd from 3,5100 in it)“ p, (.400 in I93; 1" the markedly retain the old-time habit l That disturbances in the action of ‘loos n°l~ 85118111111! avoid church or Q ' This. it lllllst be IlllllllllVll, is a rather sad stale fmps] Sh,“ ‘he ,],;,,]_.,C,.,,,,.,,, of hopsfe-hy tram of getting to the frorit.—Brantford lvarious parts of the body can be 1551i? b53929}? is: or wishes ' l‘ I of aff;,j,-.~_ t _ . N y‘ . Expositor. caused by the emotions has been 011g . at the stigma i _ _ True there has been substantial iiuprnve- flrifrllnihllflfli to llllli-had-hct free Isl looo . ably Show“ by Plot W’ B Cannlm’ ofl-Ithe trade is “Pt attached tomnh we travel fast on the Journey of hie‘ striving . 7 ~ ~ 1 ' i~ .. wll- ' l,» “H” a -““l. "ll" glmllllis‘ Wlfl {"1 l101$¢$ 501 Comma to actual facts, the Harvard. Thus the emotions can ui- 1S groans dllrlllg prayer nreson- to reach a haven of independence before the mtllt l" llll‘lll‘~‘»‘ “'-~‘ lllllll“ "PCLl-l .\ lll Al“ the production of cotton and wheat. Chancellor declared that month by l terfere with the nerves acting on ’ age o’ertakes us. The comes, another milestone, "lllll- l“ llllll "-\'“'lll lll" l’lll"l""-" ll‘l"° ll-‘4lll"ll' l" N?” Yml," l" all llllmmul Slfclfcll at ma‘ V0l'y nearly 11000 000. As for tliel what causes time emotional dis- name. The "big" modem The road to independence is plainl marked ed, Deficits. lio\\'c\'cr. continue large. The dc- l111§ll>ll"l"“‘l‘llll~', klllml “l ‘ll? Lllllcd will“ prophets who said 110t- SO 1011a 118° l turbances? i seller; like ' Pilate, inetrectiiualiiyl the highway of life insurance Wh ytake d ficit of the l-1-ilei':il lioveriiiiiciit aloiic for the expressed the opinion that. despite recent events. that at 2,000,000 the irreducible} Drs, pamus and Krgineg tell us washes his 11.31155 o; the amnocem known roadt, ' y an un‘ New Year and bids us pause and minions. 1.1K, r_.,,]“._.,,. _,,,',,i,],.,,,_,.,,,,,,,,,,S.,,,,s,.,lv_ ,-‘,>,.,,, _.,v_.ve,.,.,.‘v »-5i|ii11c thilnltf’ girIGeLaId 5212a,; been confounded by the drop of tifieurjsecstgpvhsdmélhletggiyhi; niglporgigi; ti: 1.1133111 m “ink You can purchase a Great-West Life _Pension ed and for that inznm is (initially igiimcil. that (‘u-ry tit-m‘ is _;u1ot n, _n.nl in t e c0 1n _, over 320,000 whm, had been 9,186,” these commas. which so disturb the they are not of those that "1 t or Endowment at age 60 or 65 for a very moder- Nothing has been ilone to ease the illlililCléll l)lll'—' of the British l‘.lll]>|i'C. This does not seem ed’ in the last twelve mouths. to patient, can be settled by himself or teth the bottle to his neighliiii-‘s ate premium‘ It protects your family mo‘ Le‘ dens of the tlircc Prairie Provinces and their true to me. ' I believe that we still have the same; bring U19 figure 50W" W 11590-900 by an examination and consultation mouth" us send you parficu]ars_ IIYNDMAN & 00., LIMITED Ijnl s: tl ~v zr‘ '11: vrrl 1hr ll“ll :i"-;"i"'::i\'t frctucnt. Th Britic] 15m iirc and the United Provincial Mana ers — Cha l l. l gn\.:,,i,n,,il,l|i;i] lfizllillh (lk-lflllililfl nothbcisiildel- Stzitles stand For peziclc Zliltll we shall continue %lp°lnl°,wl,lhbl;:llh'.1"i§ l‘ l)“ wag I am’ slr’ elcANT! RUM . . . r 0 ‘e own . quately limited ‘liflllllsl fiiriiiciil iliswler in tlic to Wflfk for peace” fgfrfgmslf“... “QM? 21:2?’ 8'39 l ‘L M'Nlch0lson Dlslnct Manager at Summerslde future. lfiitil they have been obliterated Cziii * ‘ll * necessary reforms and give the‘ _ t Allison McLean Difitflti- Milllflgel‘ at Monl-agu‘ ada cannot hope for its full share of prosperity. Dr. Nicholas lilurra_v Butler, president of Workers What it is their right to DeVllS Island Prison ____ have. we shall then have the best ‘ means to tight communism. "Communism cannot spread when business is goodf-Moncton Tran- script. Coluiiibin Uiiiversi ', iii a letter to a fourteen- yezir-old schoolgirl. said that the study of Latin was "the key by which alone can be unlocked the stupendous ziiimuilt of knowledge and cili- ture which the Romans possessed and transmit- ied to the world for over 10o years." Miss Margaret Louise Gurisic, of Rocky Hill, N.j., a tinpil at Princeton High School, wrote to Dr. Butler and asked his opinion of the atlvmitages The Line Of Succession \\'itli iht- birth 0t a (laughter to the Duke oi l Kent the revised linc of succession to the throne will stand an follows: I 1. Prince-s lilizalietli. ten years old, first daugh- ter (if lfiiig (ieorgc \'l. I 2. PTlIIlT>S .\l:irg-;init Rose. six years old. second This skill in timing is the secret of the Nazi government's outstand- ing sequence of suocesful strokes of policy. No existing regime has achieved anything comparable. It POTTEIPS FIELD Here paupers sleep; No granite smothers them; In sunshine and in rain The cool sod covers them. No vaults of steel (Exchange) News despatclies a couple oi‘ days 8S0 from British Guiana recorded 91¢ "Willis off from that country of eight convicts who had made their escape Zroni Devil's Island, the French prision off the coast of French Guiana. They‘ may be the last to be thus pushed on their way. for the Government of France or Vitalit BRA RAN aways use GE PE MIN KOE TEA v daughter n. twin; (ieorgc vi. _ of L_=iiii1-f“;l‘ols_trli<ly Laiiiilis w Sluflyrthe be} lgeffigllfmggjiglllfieil},lllfifgg}, lgfafgilfijjlfédflflflifl? agpoaiiecedka Bléfltgigfl, -__ ________*. 3_ H“, Imp‘. U, (lpmcpflprv thjfty-QIX years old, ginning o llL i e 111 vi iicl we now Ive allt set up an olympicrecnrd m success_ island penal setqmnentlleih‘ ° ‘lts but failing eo-cperat-ion from the, third om in" King licoi-gc V. which the youiig_people of today will have to m1 Shawna“ long berm? m, No matte,- wpen they died; "we of which m} Minlisle; eofelflfis: ZFfBhCh authorities there was noth- L B 4. The liulte of Rent. tlilrrv-four years old. live a few years 1min now.’ Dr. Butler. replied. athletcs won world-primacy in ' grpamehto birth‘ h’ n We stated was a colasfmm threat ‘b11118 615B l0 d0- - - o foiikth son of King (ieorige V. "H191? 15 "0 W3)’ l9 ullllcll-‘lllllil ‘Vllfll l5 g°lll§ “Writ: .wlllée, blgletgulersd of, gig]? l Tggggaiiédeltlolqgié. blimp?“ French prestige in the United _ Dr. L. B. Evans, noted phy- ‘5. Prince lxil\\."ii"zl of lieiit, one year old, first on in the world todzry that compares with a know» gglzllérlllfits, “As ‘Sr glgebbe]: ha; Lang’ long before: ' States and Latin America, and that. slclan treated success uuy and u,“ U: tht- link.» nf mm ledge of how it uiiiie to be going oii. what were mm m. m swp ,5 ‘eve, announced ihel colpdigions under Ylzhlcn the con- INDUSTRIAL BEEs obtained p... anent cures of ;_ ' .. . ' -- ~ .»~ '. , , . i vie"v ~~ d t. di 6. llie siriillil cllilil ot the Duke‘ Oi bent, ‘ ‘ its causes, its Ollgllla; and it: earlier history. Eyngize adllglglri.tll'att)lltltl upatl-(lelit The lwlds n” m“ m’ Tim lioniavhie b‘? beyviiglmisland WINNIPEG— Manitoba has a illolillglflllliilfls?"Ufillzilllrchso: 7. i'i»lll\‘t‘~s' .\l;i1~_\- (the l riiiccss l\<iv:il),t<ii1iitcss _ _ . I _ The udroit 5590mm of the flgm; No granne smothers them; 0mm. mm world monflnence Wm, mnnon donat- mdustry m the pm. Stomach, Heartburn, Gastric oi llarfwooil_ lllll'l_\'-llillt' ye: s old, on]; The Ccuerzil ‘Medical Council 1s neither a moment for these hammexublows m sunshme or 1n mm the memorable case of Dreyfus; ductlon of honey, reports pre- Distrem and many other nil- (l'lll1'lil('[‘ o1 Rind tieoitge \". parliament for llllllilllg professional laws not‘ gives them an appearance o, “h The c001 50d covers them, the m-enoh utptajn W110 w“; 5m; sented to the provincial industrial "W"! I'm-ill" l“ u" "(mull l 1'“ 5 ‘ .. ' , . . . . > . - _ B. Yiseonin llljUklli-a. 1\\1'l\'@ ,\‘1'P11’S Old. 11114 F011 a union for protecting proiessioiial iliicrcfiis. evltablllty which accords well iivlth ,l,l,‘§,’,‘;:,,,““§,em‘f.’f,‘§§u ‘Liffifiw sflfcil llrivilghltneyneetargollhg flllfgllCttljgflclazell Kill: Lgii-iieilfllbliildnsiiliinliiliidwz: oi the I-tnip, I< l\'-,_\;i!, ‘l lit-object of _iis existence is to enable persons £111:odypraéngegggxacptigéiniflolfyéir; Chanlbmah‘ had undersmnd: so , than it has been the slime“ of honey has mcremd from $000,000 m: name of Eu“. smmnh 9, Thc lh-iunqiilhe liWlTllll Ina-relics. ten yB-‘its requiring medical aid tn distinguish qualified Daily Mal '_ that no one who had Been broken ‘counties wonks of fact and fiction; l Dmmds to more than 12.000000 Mlllllll“ olil, srCiillil soii oi the l’i'llh'i'~> l\’\>_\_Ill. _ from unqualified practitioners. It is not gcn- 011 the Downing Street wheel for l branded by reformers as a blot or. ‘lréloladgbowllh "Jill-ll"? 0f 111018 than “av; Olga“! llgsfllafin :2: to. l'l‘lllk'\*~ _\:~il,,,,- U, toiiiizuiglil. forty-five nrallv reeognizerl that the public are left free . . . .5 dispatch from Ottawa. dllrlllg to “d? lllllllll’ °l dolllmlml clvlllzatlon‘ Its ll“l‘_md°nm°m’ ‘llow’ ' ' mmu y' t | p], p - » » - . . . . . . _ to En land _ seeme n n" to with th ~ - < t 5 "c? "llllfl "- "Ve rfllfilnd . , .. ., L ., - i t , m t Ottawa and Mom, t; d a y lo Ber e masons g.ven. shows that vrrirs i-iil. 11-1 ilifllflll"! "i l 111111“ 01"» tn seek 41in from an unqualified practiiioiier 1f P011 ~ 011 11 ,1, _ . __ . numerous tc§‘lmon|n|s "on, . .. .. _ H _ _ _ real have more skpem man any ave worked in Villll. National the world does move. Wnrs there l).,-_/in.“-_ “no “:1. the lip-l il;n_i_i4Iitci-_iif him; the,- like. .llie unqualiiicrl [iractitioiier is equal-l town m Switzerland Railway Con“ Review, may ha and rumors of wam ye, satisfied purchasers. liiloiliil \ ll Ilibl lll" »‘,l‘l“" "l l\lllf-§ 99ml!“ \'- lv free to rzictise for gain anion those who o n ha‘, no; fewer what history tells is that always Don‘ fool Wm‘ ym“ “om- . ll . H I panics an u ce t “on because s a" chose in employ liini. llc may not. however. than 50.000 devotees of this sport there is progress toward more of Scotch Fire Bricks likely to arise if you allow Llllllllre Shlblllty give n valid certificate of sickness or death. hold ll zguytallgslilggilthl" l-glfidmafiltliiti} golgffiilaniilénibglfldrdgltyman. more of yzum" to lapgcf into‘ la _-~€— i -. . - . .. < . 1 ‘ ‘ ' ' - i t . . ., I . Pulilit "Pboiiitmeiits, Prescribe dangerous“ drugs. Mantra“, I, ,5 ham that mom are As an exchange says, the colonifl Direct fro s t1 d ° "l" l’ l‘ ll" ° 8115 P" “Rn-mes: \\ l'l‘l ‘l not llll(‘ l rillvd States f) " . . - l m co an lrmllllfi _ .~_ _ \. . A i V ‘Vllillllltfl practitioners, :15 a sci-off to their legal, L999 miles or ski-lug trails in the administrations of British Guiana. O (w I Ge‘ a home “Pa”. Plll'll*‘~'lll"'l “fill ll logi- circulation ilirongllOllt status. are subjected to a central educational dis- Laurentians. Then in addition 811101111118 tffifii-OFY 811d 0f the ne ‘at 0nd Scotch ' tin» \\1ill|]_ Ci1tllf<lli~ in .1 ‘Fl't'l'iil 1‘~‘l_l‘.' ll ‘VFW film viplinarv control. The instrument marking the lllm’ l5 Wmgamlmll‘ Snowshoeing Isllmd or Trlnldild sewlal lllllldlled Fl?!’ Brick—8000— PRICE 35“ editorial on llic change in the liFlllsl] klllgsllllv. ,._. 1r ,1 m» d '11,] "n mlmfll and skating. Perhaps, now that m cs away will be relieved of 10 T F- u l ‘ _ _ _ v I v . . fl._ iistiiu ion l( “((11 qua ic .1 q . 1 Canada has become so wen and, ‘ mllC-ll worry. Unwilling to accept OHS 1P8 ny Ml orders recc ve promp rllllll” l‘ l“l“llll" 'l‘ ‘llml ‘lll ‘lllllllhldllllll ‘it H’ persons is lhei llcilical Register, of which the favorably known as a desirable; as settlers the criminals who fre- ‘lwllllml- ‘°"""l “llllll “l"“'l ll“. “.'""ll.l S" "WM-l" l" ‘h? making llll(l keeping is entrusted to the council. lahdfortdiu-ists in Suiiiiner. it may,‘ silently escape in boats from the L M & 7'11""! Nfl- 315- lfuiierl $1.111» .'|~ llll ri- l‘ iii Lziiirida. particulnrbv l’ It I’ be perfectly safe to advertise they French penal colony it has been ' ' I 2 .. , . _ . . ‘ .. . - '_ w 9'11""! lll" llml,‘ .l‘l‘lll"l'l‘ llllhllfdlllilli‘ al-ld A correspondent of the hloiitreal Gazette mmxlelgolgpoirlis £212“ pllglfiirélslseltfiigl gygidlfielgtimpélggilcihellglfibhaotfg‘; PHOlIS WlltifVeS tlllillll llilllll," will’ m“ llli a illlm. U; gtilnmlc H; writes: In n recent visit to liliglzulrl I was in the somewhat noteworthy to read that‘ boats and food frii‘ a fortnight and - DRUGSTORE i111)‘ ilrlzpi >'*;'1'll‘-I wlllllfllii‘ "illlrkiml, “iimrriylllxxttl-gc vicinity of More-ton. Dorset, ivlierc I saw a sim- 12111-111161’ aolfitisbilavzveeet" Wnverlgl Qtjjhvm adrift It seemed inhuman llm-lflbbl‘ -.|-, nip .r n- vi-rv '<' _\' - ‘ ‘ ' . , ' ,' . . to com or e 11 er resor —_~—*~"->' l‘ --1*- _~ - --—_—_*- Views \\‘llli.'ll llilii‘ livvll ])l'(’~»('lllL'(l across the line. l'le tulllbalrilllc illllnrllllf lheullollmlllnl“; dlords‘ There is no doubt whatever that " hlill~llll\\ \\i<-lt" ~.'i\'-' 0 w c“ ‘ Emory O these dlvelslons are D gllovzlng - -—_ i ‘ , ,. .. . . - ' ‘ - . » - 1 r **“‘ “M » ‘l l ll!‘ lillll>ll lziiipiri- appears to have emerged Fem? ‘ Cont‘ e gzlzildtilge lgfiagfigulwgllile 51:12“? 3?: from its zidiinidiiiit; Cll~ls not only uiibilri but w o O‘ f d 5 g evltably be that the devoibdt oi’ R A I actually ~li'i'i.:;liieiii1l. ll has (lcininrslriitcd its Born I6 135"“ 1888 Winter sports will bebgttracéed t? s re uiiilv in llll‘ iiiost eiiipliuiic way possible - by _ - ~ Cllnfldfl in 9189 ml"! "- Tlm‘ . h‘ Ev...- efu| of The‘ action, 11o! \\'1il'Il~‘, lt has mririt-a and irllllnph- Dyal 19 “w, 1935 1°11 EXPWWR ,1 Prompt 7 P - The hour is now coming and now is aiitly reaffirmed ils principles of government. And the shock ll\ peoples have suffered in rc- cent week< lllls‘ put lll(‘lll on guard. solieriilg them. prep:ii"iii.'< lliun morally for defense against SON OF GOD 2:35“! 51g"?! ‘llglgfillgirglérpsillgll; Troll‘! a! . °-‘<l“""~"l ‘l""'~'“"- ' A"‘l lllcy ll?“ lm’ he seemed 1h his lpolicY ti» bel nllelllh follows. Head- a l "First oi all. the supreniziry of pnrliziiiieiitnryi _ Shall l"? catching up all the loose ends of "h" y“, “u, n“! rigr- l O g,“-,-,~||m,-|,| h“. yigin-intely’ “ithsinnd thc grnv- DOMINUS ILLlJhlINATIO MEA D35?! illdivldllll 1111991451 93°79" vongnesp may be eliminated. s-st elizilli-iigi- in n ei-oinry- rim] n half. The dis- /\ great many people visit the Cemetery where the lllddml» blll °n°ll llerlll" °°ll' to say nothing o! III Im- piiie fr\l'l' a ro_\.'il inzirrizigc was merely a part of a ll1l'_;1-r conflict which ended with Parlia- ment (in lop, imPFesscd by the, siiflple monument and the iatsiiggugprmnythm of] 3mm: your condition. H . , i- . , . _ ,. , - - - - ~ - n em s. a as . ' lii lllis uiiiruciicv the lTinp-ireanipresserl mrniioiis words of the inscription. Where he a the "w Irumgm the“ sponsors f, F Hutcheson & s’ “hole “fold “nh iit pout-i of hliilfl and fl('fi~|\C iThlllCfl was about an hour and 8 half walk Md dreamed o; and mwnded for Jo o . d action. flliere was effective cc-ordinatiun of the ' c opposite to the Moreton Church. iron the place of his \Vl1ei1 the Dead shall hear The voice of THE ‘lxiwrciice of Arabia" is interred, which is just I was much And yet It is difficult to explain precisely what it was in Joseph Chamberlain that >0 moved our tributlons of unknown men and women, the sweat and sacrifice of so many soldiers, sailors and civil- burial, than, but which mm before], Satisfying and 970ml" N‘ suits follow the correction oi‘ provernent In vision. Have an eye examination to know H & N? BRIGHT CUT A soothing slow burning mild smoke always fresh because manufactured I n the province.