U s. p AND PRINCE COUNTY CHRONICLE l ESTERN GUARDIAN Alberhgndv .. ‘Lengthy’ ‘Debate SENATE SCENE . mil-FF“ Optimistic iiovi io Aiiiiiii a (Om from 1 # your order to the boy responsible ior dollverlea on your route. the Institute am . , a - 1 arm's-mm... eewaiee kofllggg- ' _ niemunyirieisa. gmqup o F h . summsPflg-m um "mic. commute» an l fium‘$mum_ :11 (continued flroln page _ m1... waaramia aummnéif‘ VGI’ '8 111$ 5 - m. Sllblollllflofle several-m llwlld be rm will: In. rend "out min length.“ '.°' m“ adle. h 1 i fixemififihefigfiig veil we , --—- t believed almost all u. . orn- r t t eed d . . no Giggles: mo! be bonlht dell! at an! oi the following atom in Miss Mutant Oehili, yllo n. appropriations ior deienoe wilxlxegie untloqgeagar Clanlo‘, lt- or fiaffifisi?” i weak, wit; , "wmimn w“, u Gm,“ “Mg was operated on iw‘ - devoted to the alr ioree and the um. Ibrdgn uni. , a per- puns. And Iona oi ‘ma. in a. serious g “N”. 3*", w“. m. m“ u. w Wale: 5e. dioi in the Prime County . Present personnel oi roul “up”; m u" t; let-hack. Riobeia weakness can -. - - Granville iii. tal is convalescent at her homo ofliom and. mm My b0 °W1°¢ A- a human ior the British (c. P. b Guardian’: lpaelal Win) aiwa be traced to Irma’ 100611!’- Gwfln ‘u. b, Mm“ u M. . willie additional equipment, luelud- . m,“ n“ u, “mm”, 01-11%.‘ y", lpqpumum 1m emu i-iolueis ebonuup on ‘h, its dnyqrlfiu at,“ ° 1" “"""°"1‘1° 1'! i i- 1" 11°" "*1 1"‘ "“'P1w"iw111 1” ___- . that w. ohamberieii. and Signor over ciiiedem iiah industrial wu __ where the owner is min: or 1' P" PR" Phone 889-1 m ihll eerviie or 'I'he bukot seeial and dense in “w” - - misielini eeel. had stated his poll- exnieeeed 1n the Speech m... the mimrlvn hllvlha chow ioodl deflo- h d” ukely that the defence Brllhant Assemblage tlon and understood that oi the Throne read 11y Governor-WHEN m“?! mmml mum“ “d 1'1"‘ . . 0 end based. Crowds Chamber other did not mean their points oi Tweedmlulr at the oponin: o! on mug elgeggffémwflha "mm '.< i’ s. l’: E r E a s é‘ § in E .3 a E'- n. 3 5 a E l i: 3 Q- s 5 i. r i; eolnnin iareaerveil (or nein —IiNGL!8II coll chain tor bob 1°11 Hm!!!’ 0111b. was lnrge t- - i ide tidal. It l Parliament. . .,. local interest tut vertlnlng or eleiaiils and lnud diggers in stock s. tended and' veied a 'Ill00e1¥fl‘ll1 m‘ m 0mm q‘ “m” m “he my. ' ‘QSLHZ e...%. theimetrifey rue Government wave nssureme °1 1"" Mm“- ld- ‘*4 "gfgil- """."""".:.:':..'.~.i"'°"°‘ ”"°°"' L-“dh-d- .""i.."r- “r? "sir-v- v» 3.2"... vuh‘i;'%°*.i;'if.‘2§i‘ee§’é“?e'§. For Openmg pa..- W. ,, ,, ,..........u.. i» ti. “miauwmu. ~ refit“. ‘--=°°“'- dfio =- vi 4 eon a a W o llly- ——— h o n once iirrnislled music maohlng com ettorl l‘ one another." m" m‘ oi the ‘ma... ‘These well know , 4mm pom: i . - lamentar ere- nu i ~ u. in - -- ,'= 1° 1" “""'°°‘ suns in stock et fir? 11.5% or dancing ___- lowmeginlatle at?“ mgmm tehngniodheavieg y C Halllax i... Geneva fiiufifii s13: eirui: uiedufs 1mm,“ $3195 ‘fififé? $3. "$25" Y vm“ roman m 11"“- 1-491-1-4-11-18- Messrs. oedrid gm” W, Parliament a. sirlglegeelssloil since m011y~ o! ihztffiohgfagtifchflhgxlh best. "a" is for pelts? and "l?- in throo 410cm! in the Keuslnutei. awn“ ‘Mm’ w” "w" ‘M’ téhiieieeln l936 hevgsgubuugd Th’ “m1 °°“"°“’“°“§, ‘It? it'd»... There wesalee i... aiiet- §§§§,"§f,§§§p§§‘§,1'§;u‘}‘fi%‘“f“" at xeueinehon. Friday. Jilhlwrv Rink eetiudey. Jan-van l4 at a 1' 1° smmmd" iow menu... ahead Ofsthem dl t! (B! W- W. MURRAY) °°“°1“‘1°‘1 wPm“ “mm” m‘. men‘. ei sazooo lei development oi o, New“ “m,” B,,,h'-,°§§" . Tlmndla n“ nm- W111 11° g1” h. m» Sumnieriside Crystal's vs l’ lng and dobo. the serleagesoi ‘(3811111111-11 7"" 5"" will") cmmbermn‘ m“ 1° Mme s deep sea fisheries and the demand m, m}. m’ “taming and essenmfi ~ 1 1115111- 114544 ‘n Keneimton Silver Wings; hour's Mrdh Jam“ wen‘ 1"‘ " “m” measures tong. OITAWA- Jim 13 ~49?) —— h“ m“ m“ “£1113,” v.1" tor tish. mineralsioeoilnteraot any tendency ——- . skate arter- lsslon lo t° armmw“ '°°“‘“Y-- medal point o! the padeailtry “"111 mm“? m m. _ “Continuous imIDPOVOZDQM ln the in rickets. You'll find good Niblllll BUY illoich 81W diwl- W‘ "m- and a0 eeuis. 1..5-.-1.13.2. Included n. Prom... which slllrollhds the opening oi 5°°"1"“Y' “"11 *1” "° 11°" ° eesitioi. ei the iishim industry as renew steady use The latest ieodi . _ bolts, nuts, tiles and a . Miss Elizabeth Aroenault oi’ Tig- Parliament the Senate today over- 11mm" 11115111 1°’ 1" League °1 N" a. whole" said the ‘Filrone Speech. schedules ma be obtained withou i5. L-34-1- 8-21. K . nisll was a visitor to Alberton re- The“ mclude new attack; on “n. shadowed the House o; Qommom tions Council session and will in- “h” beim renewed m annual 1m change by wrftmg me company '_'—" “mm” employment. The Government's in the brillianoy o! its setting and mm‘ 0mm" Bonnet’ Bench creases ior Llle past few veers in ‘ lullgunn-‘mllm u” Pun" r long-range program oi public un- the dignity o! the ceremonies was“ M11113”! M u“ "sum M the aggregate amounts received by 00d v01‘ 01110!‘ I810 $9 TlY1°¥ d V’ ' ' M1’. Wonk O'Connor has ret dertaklnga such as mining’ roads. In one day oi the Parliamentary the °°“w’“°'t1°m- the fishermen irom their 9°»K°11'1113m“- an 10111113)’ ‘*1 5° C1,1l1'1°"4=WWh. P. E. I. to improvements in the national parks session at is“; the fed chum“ u T116 311M111 “The depantmont oi fisheries e Bed mm; to- —— '°‘“"‘° 1“ “lldkflht 5- D. U. alter mid improved h. nway approaches outshines the lower house and that °“' P°s1t1°n °°“ 11° ‘hf have irlven and will eentinue to Gonsgryallygg HOCKEY eque M; My,‘ Amman“ r Chan u Spohdlna his recent holidays at to the parks for he convenience or 15 me day o; me opening changed ainoe we started 0n e gm increased ammo“ m me t. Friday. January 18. Middle- town w“ a but!“ vignor to fag: Alberton and Freeland. tourists will be expanded. AS l; reflecting the dominant expedition and that position is problem o; nmrketm¢_ The cow I Jllhlm Yd- “"4"” 311"" sinister. Wednesday. ‘- No mention was made o! the 5t note ii. the Speech ire... the S““1°1°"*1Y We" kmwlh" eminent have also assisted iisher- flfgamzed For ... ..-. 15 cents. I..-8'I. ___ The mflny {fiends of M11 wag. Lawrence deep waterway project Throne _defenoe __t_he an“ of That was interpreted as mearl- m“, subsemuaily thmwh curacy, ._.-.-.- 3m Gem son G. Hard , leased to 1e although the United states Gov- . lug Britain still is unwilling to I u MorlomN-w- Jolm A- Charlie iremn§°w°mue“.ee§n“$e.u1§.'£ that she 151111111511: flworohle .53: "mini with“ “l” W‘ Y?“ 1"“ Kfilitmeéiieefftfie? “llfiseimtifiifi m“ “finish mum“ “new I“ ‘h’ “m” 11”‘ m" “w $888.0 ll h l oi Simmer-side war called W esr visitors to the Western pay-f, o; grass at Charlottetown where she ma“ “Wmuhes m 1'11” bamdm" “may Franco Iliad-rent T1811“. 101' 1Y1‘ estimates sot up a fund oi $500: I n a a v n. N. 13.. 0n WHIMBMY 011 the Island. _is receivln! medical treatment. $vemmem “mine ‘m “my 5m“ Alfthe c010, which heme . eta-hoe. unload “ol-lbol-ohi-lhl" hum‘ 000 "to enable aidina Iisllermen nt oi’ tho WWUOQFOUB ._._ _ - _ bel- of Italian troops are Wlth- or irroups oi fishermen and others _ is rather. a Mrs. p. 1v. residue was a. visitor Messrs. Milne Corrie and Rich- '1,,“‘“§,'§§§"’°° §1",§,‘.‘,,“,,'§“§ a“??? 3i"i%“i‘.‘.. fiiffilfiyWityméfifili- “"1" “m” 5PM“- °° “Wbum "mmsdv" 1" ‘he 1"- ot that cltyrS. toSumnlerslde on Wednesday. ard Simmons oi Montmee, P. E. I., 513819 men” Wm be °...,.,,1i1uY1-,§ “on in this respect wuklven by Italians have indicated it is diuptry.” Under an arrange-mentl UITAWA Jan 12 __(OP)_ 111*" "lull" "M" l "W" "111 "other weir of uatieuiii iiupeii- the elements themselves, for bright M"-"-‘°11“1" 1“*’°“‘1°“ 1° 1°‘ 58'1"‘ Wm‘ m“ °’°"1“°°‘ “h” D°m1-“1°“ Plans for l5 visorooe oflenslvwp- EGION MEETING-Tho N8“ Mr. William 14:31am oi’ Monctoi. to St. John, N. B. “we” In“ yew. $200 00$ was voted sunshine poured down wml a ‘are a1 Franco tight. on the present paid ttlvilorathirilh and the provinrées on the “bun Admmismmnn ' ' basis one monthly meotinlz o! the Sum- was e. recent business visitor to ___- _ _ oi loans necessary or do h m 0! ‘£1: cangag’: K911513819“- Mr. e A’Hern. Spent the grkawmmtiglrlestvryrkegitllaerxfilglellltgl 'fi,°r.i,l£fitifi%e,"_° mid suxmner m Mr. Chamberlain passed the aldl-n-R fishermen. gewatlfvi: bgplgnomgg‘ :2 mfngtfé; n Woo i‘. 011 99583’ i- week end n Tlgnish, P. E. I. stations, Grants were also made for day visiting the Pantheon and the caucus mda _ . Noll R. Durant. 019811119119. N1’- Jflhh L. I-Olfllhatt was a. bus- ___. "provmcmilsuoperaged fgyggtfy “m. unknown soldier's grave, at an pk Th y 1m“ $51M‘ '41 Kfilsm ‘ 11 on Wed- Mr. Ioonard Burke o! Tlgnish, servation camps in Manitoba and Regal PM" Amv” audience and lunch with King Vie: I sewazivglllzjlvluilrgrlglztmggd it ‘fir’: “m” - ___ was a recent visitor to Albeirton. Briafih Cggllllldllblfl-tralmng program Gsharply Cat thrice ddclockTw the mnmfige}: rgfmsv11gl1ggfom Y: LDK loaning. Every) Hwfllgbfn ha: ' y _ Dame Md; i“ overnor enara an Lady aas- - B911 in I 0 B11 W"! e M" m.__.._"1m'_'s' Gollgrald McKlonzie wifffiusfiegs of.‘ u“ m)?“ w11°9° 91nd‘ wgmspe°°$mh$ mulr, acocmpanied by members of Mmflcsrbmm 1° wam‘ “*1” I , member is expected and has a- blzilgblbwSogikulilJiglaTlég loors to Bimlmerside on Wednesday. fiflgn? fisfifi amiilli..." trilli- mg? ii. eiflcienoylarld grim ithlihéapfirflolréglt lgfifehggmfiéw” “'1; 1'13: prelim... 1e.- uie day eiided fiffhfie “jffl: wffifbfifg or low - - - i studies at the iesoeetive ooll - “m!” w” “m e t i u. Pri’ ' m. a with dtlohdhhoo o! e sale perior- 5.0,, d Rebecahs held another All the adiool children oi Ken- Se‘ m“ years ago with an appropriation oi 1‘°°'P ° e 11°95! e verdy open "Falstaff" - [new], h. were M Whelan and Dragoon Gu ds. mm“ ° s ‘ ’ Several committees have been ‘rig mfig fiwo hom“”m‘flfiw (fn1‘°wedn‘°§,da“1“ lvianeit to N. n. A., at Gharlotte- §g°t Qghiigngélgeé gllgglgfogge The“ amifl. was slammed by at the Royal Opera l-iouse. n a w. u u, d". Wm, van,“ pub.“ We ab”. m," “M” o, utter-noon thro h the eiiorts er "W11. Mlwes Elizabeth Clark. Mil- courses “e Ne“ 1,, ‘Qfg5ury_ the thunders oi a. lo-ouh salute. n. quest one. suoh as defence Ind un- lmu wmmm way B d“ m; 5mm school “pl-we. dred Fraser and Hillel-i Wells and I “mm. domestic service from; o; the puumml; alluding‘, employment. The members oi “m, M“ Dbkmni ‘mm: 11mm 506W! llld 111W 8911151 R191! MT‘ own” Km’ 1” P‘ w‘ c" u‘ and other lines of work and an at- a oompany oi the Governor Gen- B ‘t!’ G 1-119" “Infill-WM W111 b0 wh- flmti - ' m. Company. Charlottetown. and Messrs. Roy wmv; made to pgupg the young eral's Footguards. in greatooats and rl lant owns lcAIfiARYhdJan. jiil-(C?) 70A: 9d to make special studies m‘ tlnn ieitl. smlih- euotiui‘. ' ——- 1'°°1"1~ wm- "h!" N"! Kmwh people trained ln galhiui employ- bearsklns. furnished the guard ei _ m... ieki; g... ‘Idaho-end 0§>podhté5er_ sublet-is assigned to iheiu and lm-Iust M“ Wm“ Wu“ ‘Ihe Government anow plougha, Charmer. to Mt A. Sackville. N- merit. hcnou. Acknowled-zinii the Royal 1 J3’ I gnmoch: “"01",? ‘Mb deal with them during the de- secon‘ M,’ Mouxmlm ‘m9 ""5113. 5mm chF-JMW H B- Salute from the troops. Their Ex- _~(Q°"m11'“°d»fl“m .93.- 3°71 :< 331,13‘; 115mg“. 831m $109 was hates. This will not preclude any “ML gmflmm-d Qay__3_ firm mmwsu-nWifi1-‘1di1-bgpened 1 Ne“ i" minim"! 1n mud cellencles entered the building by the ed o’ he: voiwd here last mam b m“ Hum member from speaking on any "i" 01311326181 Chn-rl iowrfeen from St J 131“ 13h” ha”? be busln sion and the mam door" M; m R- B- Bemett- 1mm“ gum Mm‘ subject he wishes w discus.‘ NUAL CHURCH MEETING - 0 . . -. w ere o Despl a ess reoes A alumni. was formed inside. ' ister cit Canada. in his "farewell" w "——- vnent the holidays. _ continued ombamssmenis and headed by me Govemm. Genemi, Around a. rgd-oobiéeiéerg viiogldgfilf address at a civic banquet mm m wwfiwumfliu guggoghgl°tmf '—'-—- hammaps 1-11 49911118 with unem- honorary aides de cam-p. Immedi- gemymm‘ mmemamy we supreme his honor. Ko - . m»... . 11nd ., i eech _ id, te - , sinawn on Wednesdey. n arilswbegdwelemlsltlalel-Mlll am fitfidfiefiififi“ egibuiieefain lalhlgapfit §é51§m§§1°§°§111§§r 11,1?“ (fflh g‘; coilrt iltldees msatrbbesuuetlrr‘ wsrlxileerrilaig thf1§£§f§§;‘§%§fffi§g1§i'g¢us§{ P011117 & Display —-—- E351 , h i 'v- .1 . v ~ ' ermine- rllnm . . n” Tn“ week] young people?’ the“. lgcginhzirhbig entlpaiteé mtrlelfieilfllfl num oro Deon e recel ixarln, his striatling! oilillagefieandngol- blwk m“. whes and 5°f{-p5tgnt_ gm i3; gealliiauiyfixéutalzrfitkwsggegulgi ‘grewaafl mmegnaltiilthe B0810“ “M om" Ameflu“ cme" ma; " lflfimfirfiafigoflfih? 311d £333: Yézixlfg rand Mlqon r R8231 151353. $13.5...“ ifsghewttfiill ‘w mwregt- “mmembe ‘n he and‘ Continued irom Jze - - 47W“ r ...__. ' ' l ' -- tugs 1mm it. ..._.___.._ _2fl _ lg "B5110? Wenialihe winners oi i. e m annual“ 50m“ who staolesy placed in the way oi eiiect- Dohdurarld, Government Leader l" court umiorms oi the Privy Coun- mqulédg" 1' 11" 1115 °° i E E a mu t; reapecg- "hem "m, b 1h the Senate. Both wore court dress. ill and diplomats. “m” ' iveiy were. Mrs 05g. Cooke and 1°‘“'"°Y°‘1 1° mm“ °11 mm‘ giyision oglayolxlfitltlllxggnsfll lillhl1°flig Rmlkm“ "mws ‘*1’ N“‘1°““1 m‘ c 15111:“ “hm” m“ “by m” 1° $591 lzpalgatldnlrisslgswuéhfiift Ede smedlnthefieiife tlgemgiegt M1‘ M11131‘ W91“ - d“ January 5th’ w may u“ 51' between the Dominion and the fence Stafi and Commanders 0i’ deoP Bfiufl-mfl-Tmo W" "W114 11V m AI resented to the oi the Throne to hear the mar. u hem“ m m “he fink he" DNWMW- 111° mtawa “"15” U111“ “m” “twndmg me °pe~mng m hotIgied nears p Ma or Andrew ‘from His Excellency as represenst- w. William Ives ei oharloite- m“ we" 1"‘ 91° 11"“ °' "1" . 1i. uuseenneeilenli was ludleaieu brought up the rear. contrast with a iew plnlie. mauves Dawson on behalf o, 5mm, cm mg the crown town was n bilslnear. visitor to Klen- 359-15- 9°°Y° w" 74- 34°11‘ 1°31“ the oi’ the commission oi . The procession moved with and deep mil-berry eludes W111“ mus ' Headed by ‘M, speak“. c» simian on Wednesday. W" 1h imihmt Mm W! I 11"” neuirlflfiim . pievlneisl relations measured step up the l-rell o! added a a lash o! vlvldness id the . 8mm Dr Nth-m Bunches” ._.2_ game of hockey was played I would be presented during the ses- Fame. turned right in the rear dmmber- w flowers were noted Recalls Camps-l n. 1 g’ ' d m ' Mr. Cliff-Rodd oi Charlottetown --i' plan, It would provide a basis for ggn-[dor l‘, the mama.“ 0g the as aocenta to the feminine cos- §fi{'m1°1G:_h° 1506111811513 £1“ 61:11: wusavisiim- texeuemqieumwed. Inspector Scott and meuterlant and the material necessur for senate speaker, mm wane, m tumlea but more iur capelets were m. Bennett’ present member o, 801 den mfg; ma» Comgmm nesdny evening. Anderson oi the R. C. M P. at the deliberations oi a. natlona con- Fume... worn than in former yeorfi- Parliament to, Calgary west’ rm... marched in Dim w the b“ or {he ,_oharlotietewh were peeentvisiiors ierenoe at which the problem of q-hegensie iiseii vvss crowded. “W”; we" ‘éfafffkferm ‘kg? 38$; led peitleal odmposns shortly ofior- Scum u, hm m5 Exceuency _ . . ~ i = k w" ‘Mu’ m“ M 1mm” 1" 1° Mbmm‘ P‘ E I ‘mmpmwmm and m B" Se“ m Jmld“ °1 t1“ supra“ “"11 1“ aspeaxm sgi-adfi Mrs. w. E, FOSWX‘ and 1115 mm" he" i“ h W111‘! “W” read the speech in both English rreaenti Swift Can 00., is i? rally uld be considered. _ _ a visitor Keilaimton on busln- The curlem oi this vicinity ab‘ [flaflgaqovziguuxierllt still‘ finds: ifrhglggckarig Flrorrllgieofofiiépgrtr J51: fix ihafillggfiempe fro}? allhfiotwaldfiz ggfém angetlirerlcig. m mo“ own chamber HI- " enjoying themselves immensely in no. o unemp oymen. ilran a ‘In Dd f i m.“ ' - before he leit the M timed. “"1111 . ti lto one!“ ° er ° p" m r5 80W 1551110116111 M911 a b°d1°° °1 _ the commoners lost little time 1n WI o. c. Bu“: h" on ma!“ the Cirrlinq Rink here. solhgleoitlsga theh fgaploy_ oi the Diplomatic Oolps. the ior- male beam much flowers were neBnirelf&esaoigmllllégwaig agalgaryaldemligrn concluding their fomalmes for ma.“ ‘m, m! m Wand tn 1i", _ ‘ roblem elgn services, representatives of tho appliqued on the full skirt oi the m 0mm _ N_ B" d m“ h h“ the my “g “Genuine M"- H- J- 591ml 1°“ m? H511 m?” t Wm be caged upon to ohurch and members of the Senna bind; net, gown worn by M185 dmwn ugflw wwygnbylaws “$0 rd m “mun men “Bill ProJ-‘ormd’ the h lax N s recently to visit her - Nailed-lg] .511 11b 3 u M. ' ' u. c nadir-United Sta- had seats on each side o1 the churptte, _ m"-=____~—ii1“ ‘ '°° m‘ “"--°" ”°‘“‘°“' "a..“'=1rh°l'i‘dir~irii=sihi ..*: “rs...” Pr. will? this ‘"i:°i*:."*“...e.nh B.» J.,-,."..*“"- ... ma... ............ a . a RHV- Wm‘ v- Mwmum w“ ‘ mentifvieth title Bgltish West In- women. Ohnmbers with Speaker Unsaid-lo I géemalfiegt I maucflgg‘: m, i-bm 9,040,111,» which “m Elmsdale and vlcllllty "W!" "18"" W QMYWWMW e, 1, pmjeoted All stood as Their llbwellencies and their daughter Mm Helene. be able w discharge“ "an act respecting administration ' 8°" W“ °' “m” at a banquet before he iert oi oaths ei office." This is dens i. mmefl ivlthis- tdthOhbeJrhGo- .Ol-5K1'lm 401m g Matthew; 9f M; T“ 5115111"! °1 ‘M1113 1°’ f” 1d,? was, “its... in {B25 131d ngtloé flxflraraerleril tooalznlllxs sea: onvtelfie 1119531917 5111“; mme- d“ ed Wm‘ Chatham ajournallst told Mr. Ben- every opening before reierrlilg to ' ' ' illvllro use ensued ill by Mr- GM" 1t mt the and oi 1939 Ihrohe Her Exoelle seated on d‘ “"8" “wmme “m1 11111 1"" M1“ tt “I h d thr uauties whieh the s h from the Thro —tl e 5mm“ Umvmflw 1‘ ‘pawns m‘ lei MoBeath and Mr Jose h Cal- w’ mmmate ma“; he h i t h my Helen. wow a picture (rock oi sky m 1‘ ee q s bu" we” . n‘ 1 “w” " m‘ .h°‘“° 1“ mm“ lsghan is meklnr mold It- dod "- lrruegotblgte: amiiveeg‘ p201; 1111315110 iiiean- (bym trh; Prl§lelei§lln%£l'w::ldna&h8nke€ b1“ mm“- ggtfifii veganoesg gguiiiiggixisa} rglfishbtugo ldgdldwiltgh Lint: u. this 1m- T- A- °1‘°""- Wm’ °1 t“ anduiiho essential 0i the trinity. own aiislrs beiere taking up Lhcsn pleased "m! 1111"‘ ""1151 - T1" 1°‘ time and wi ln view the tor muduiand, with aides and e:- uz. i?» Olrlenmhashg ""1" ‘° 1" 111° “gmm” "14 tutti beard has been iiistiueied to mere rrouped on other elde. $91‘ ffofiffifiocfi”fl, 51mm Fammeg sall- ,, , ieieired to it by the xiii... Tile _&mn a meant illngg and hopg to 111:“ 1' ma" ' h? enaiimlm sliiznr Urolormofid find B1311]: t ltnlstrugion 3 Rm, 1m, He, daughter, M“ 130,-. m§c1h1§a c?“ mmmvfltne ‘gm: bill ‘will not be heard oi again this $0“ _ -'_ I 1 Q, C Dug O UUQ l ' EGGS OH. n‘ h“ out "an m“ OOmmODs to the bar o! the Senate. §kfli}1§' fifirgdbta’? tlglrlltfi the u“ V3114"! 5W1"? 11m r1111 "Edge" mg Adjournment was taken until the students home ior Unliod slates Pool to hear the address irom the ms ma“; “mum, wire o: the gmgge mgféeg whenfie o, g g2" tomorrow afternoon when there m“. mud”. m’ Mk,“ _ c Throne. This was unusuilll long. Justlee Minister wore a princess digger out m, a wen to mm a will be another short siting. Olive HlardmDol-ialiorne and Edna ——-—- The URI-Md 91am weemgai and His lhioellency delivered it 1h gown in midnight blue heavy camp,“ n Mk Tribute will be paid by party Johnston. paaa-l) the Speech 511d- mfl-Pk“! 1! F“ 1' both English a French. At its ole ~we m a F,“ human sym. leaders to two members who died mdl-ugflqn 1n the tllXH 0n “M19 conclugkm the cqmmgngm ‘ gghgfl ggfln brocgded 1n gold pamy m moss old day‘. somfiflm“ 513mg thg 1331', 55551031-3, W, Jag. tdionllncl been made by any DIW- ed to thle. own Chamber, and. and a white iox wrap iash- we had “Rummy; u obs Liberal, Montre-gl-Cgrtler, M]. ' -_i _ threads . Ruth MIGNOQI 0! Hollngnfig flflVfll b06111 Whlfll DflIIfllOd 101' 10m Paflhmeing 01- by any 0121181‘ with the dapartm-e o! the vice, “med me 313mb]; wom b Mrs, but it dld “at reanyaiien our 1% and David Beaublen oonsen-luve, VALLEY QUND 1 fl lflflfl Ohflbhfl t ll 1 llflfwtulfid SCHOOL CONCERT.‘ 1mm; u a wmmiom ‘or t a om- eountry in reoeinit years. It open- Raga; party’ the Senna g down C A ling, wlte o! the once 1 i m _ Brlndom ‘=95- w‘h‘<il'@d?"““' “" ““‘ “m” °’ °“"‘c‘ “‘ “‘° “' °“" r “°...§‘*’.'.'....‘“§.‘.‘§.‘f..’.°‘;e.?ii.‘$$3 “ii.".‘s°e'.’.‘.‘.".‘i.‘.l"°“se.....eg°..i ... tiirhsituhiiiir-‘iil ‘$5.533’; ...";"°.::..::." Beatriz’ our F“ cm“ “in” with the ilsrreemerlt between the dependence which both Houses mbwm ‘fitted Wm‘ ‘1-1“““°"“*' their reward lull o honors, They merit and Prime Minister Mac- Mlh t-hll vicinity attend- - U m. Klrygdcqn pd the United d, .J. a Mlchaud. wire oi the 1 e1, t __ , . l’ u.” it sand Hurt l-i " a we tra tiorlally make -a claim to the mum“ Mmmm chm a 15mm gflatyfivgi cougar” e:hdm:;is°urr1igifuili_ Igiurlgiciévlllgtigile 3:518 16321;: *1 '1"’°“"1‘1"““‘°““"”°é’°‘°° Btateswas a. con- riiiieithse ' 1 u i U YB b0 ttend CO lie! ' . chum’ ma‘ n‘ “nth” w“ nmson‘ ‘m. the ham‘ m trlblltlon Wwflfd B bemmem c‘ hi5 own basing: befor: taking up m” °t m“ crape “mmed at the X1855.’ he Sold lIl tfilllflfl 0f WISE-W's as a royal commissioner, investb ideeliindtheioadsaaeuiili heslredmooooooend -- . it . "rol~....-s.~l~~r~ do?‘ .. .... ilhedgtniii: "iii m... . til..- E‘...§“i’e...’§“§i.. “resold... sails "o "viii "or i» or memo» . . ii - s. ~ -, . i. i - the won - ma?» the ei...“i.‘-““...e‘?s’.ii'éii‘°.i’.' “ti? thingy-ii»- m, ikii“°’u°‘iwéseh‘awi‘ésti“y‘é‘ifi it. ;‘,.,°,§ve{f‘-1f§°,§‘“§,,§,j‘11"“¥f,;; .5135“; "3l?'r‘s.§§§5§‘" s‘... vltgeloldhle m..§..°“1f.“$.2‘ .2115 eiéfiPtiemiififi miigglggsghghggusmwigglggig “WWW 4N1: we gull-broil” w “ei°°i§§§st§a§'ete°de§? iewetppkrgsisieieiyutfziolio. er be orwoflgg‘ ‘gghmmggwm, l2; tlnemlest 3m will be heard oi it ilipéihyet eieukvmdgsllliinei 3...??? °°.l‘.}§,gymgg§5§ “gig m mm ‘ the neg‘ mm}? for Brrgzlgiflll. ygu , u 0mm“ 035m» m»); _ $999" n ‘r session, .. ave e r o . e itation -by Aufioy Qtovalli- v9.2 defiantly to probate ior quanta?! w m. “n”; Senator Daridurand then moved fittaflrfi 111m lnfifm“ film he “Ego i do!“ ma“... address in reply to the speec ircm “lav”! m w summon moducflm d munluom m m, m. Justioebuosenhnded f; m‘, that the Speech from the ‘ml-one A princess gown oi waltz blue “Hive a drink? :1“, I don-t the Throne, and Lionel chevrler, " “WIN Glrieiqu Month. e: the u“; menu 5mm, L - oi wnr. 1*“ W"! 1 D" Y L; be coltsidered by the Senate on with touches oi pale ink chiffon ui dmk.» (Lib. Stormont). will second it. Put '1 dammed mm ‘Llmumow mo. creation ci a. three-maul Tuesday next, n motion which the square-cut neckline was worr. WW9]. mam mm the He]. 800d Dr. Manion. as leader oi ilie taiien 4h m, - i- n, m, m, n“, m eion to reolwo the WWW" e" - carried, and the Senate adjourned. b Mrs. a. 1., nsie . wife ei the cup- official eppesiue... will probably Y UIII- the lonelier! limo N!’ '14” m“ Gratification was eicplessail that Kym '1'" Y - mmf “dub ma, "Mum m u“. u” “m” u; you"; pm, m m. “wand m" o’ the mm ma --____._-____. a nal Revenue ister. , hi. load oii the debate with a critic‘, _-- . ‘and duel mam aeatriee and Lola O'Brien. gaiggydgwW-fiixdfl ‘f; Queen would eniin-aee all the brovd- Contribute To . _ Inquest Held Into “Tn °§e§§§i'§’§s,°'§“'s“.l'i',§§s 1§§°1°§h mi 1 . ‘i initieuu deienoepio-1"°°"'“du“ °°°°°1‘°‘1‘""° add hasbee shrtbtl! .. ..°‘L..'.;'.?“8‘i.u%' a‘? '.'."“"s2.“'“ °' we“ ...#"5.°'2.”°e..i...i... . much the w, Mm rglwnmlyeglo 333g Defence F111"! 511311111111 111311119 Double Tragedy miiittsi... believe ‘l... °... i‘; .... " 40M Wlamoie sin " iue”..§s l?‘ ‘o vi m‘ Wm" ‘"1" 1°” to Canada 1 t suiniuei- de- i ' f N °1°°"1°“ Yea‘ "h" m" "m Pm - goth-p my . - — . - e e ~31,»- wl- sei- o-i-a m... i...» ui?" 6.14"" or egg- ~w-,~.-,.r;..1r;.r<*~,r we“... i... indie...» “Wig wiiwhmzmmm- with; 11'*°°'"Y 11 °" adv-Ester i-i"i.:."...-.. ‘.2..“§%‘;'...“.€.‘i.“"%“i“....’é‘.i°.'§‘.°.‘..§2 W w,‘ “m” T’. Ohrmmu '1“ m‘ ‘hwhhr’ cludlnl: $210,000,000‘: the 811$ Mmunmnm 0mg“ 5M m” Um $1’ "fflsoummmmm 1° 59M miner "shot and killed his wife. occasions in parliament when . gmgh“ Gama‘ ma!’ ' onoy hind. would ill-U b! ' , “t ‘ o“ ‘mm 1'3? ‘grimy’ Jessie Butts, and then took his own they may range. in their discourse A very lei-rely attended eeneiri °"*v,°‘,°“°, 1 11" nicer-national AHIIII 1.1m“ m, £25.?“ 1°‘ ° 1"" ___ 111*’ ‘flledgllgonlgfhi "m “fxflwf “fir” vlhwflmlhlmevi" 11¢“ °1 _ ' a Olln 8t U88 O8 8. me . ‘m 1"“ 1" 111mm" 1"“ °‘1 mm measure wu eoniined to mum, u w ‘lhelmpllm was unanimously vot- mow YORK Jan. l2 —(AP) - {f3 the double ma“, ‘h, “m, 11f’ m“ Wednesday-Dec 2i by the pupils fl _ ‘llouchlnl M °11 9d 1881’. l-lcht by the Bahamas - Lincoln Ellsworth leader oi a . 110111!!!- o! llmshle School. The tenonel! §35Y“1.,,2“f,‘§;‘ £1. hire the Bneooll said Canada's re- islaturd on n measure introduced gm“, Antarctic Expedmon, 5am loigltits cottage in this cape Breton mm A‘ hi‘; mgu-lheiuerwlood “llama” ‘h’ L1"“"" u" “mm” 1°’ 11.1% iylrlendlivm migirlimaaevrn ive 0.9.3‘ a Muiairlwgmiltlgel.‘ ineiiou ior iiie 1“ " w“ “,3?” ‘§,°m“‘°"" “M1,,” deal/Zn willie-awe inoludlne the ADJUDICATOR 0d’ do um mun,“ you“ we“, g l» ‘ H I I Wyattlixrpto eN Amer“ w was‘ d M; 1 u, d m '. l, tlle' tigi1i‘:.firmi1i.vnieo: fihmmidsHwfifl‘ i. vflfii 11: - MM?“ wagcqwihgfinrgtrém 13E? 513mm °,*3§m1v-,w i“§e"“".....-."°’ filfiiwfJln$°ie3g§ gyilgl?“ 3351?; °g=<i5gl ___<°rril=.llodirm_vci=i=e. - umil?r 'Qpl.-|g 1“ m", “efiu-“Q m“ 4”‘ ‘° navy suoirennei. the wmlanatlon °°,.,‘.°~,L'}m§'fi’f,~,f-§§§- diner vot: be made year i: ‘"11 m‘ 1" 11m" °Y° 1'“ McGillivrny. ' ' coilrae oi’ the interview that he . 50mm _ m m Y Aingvohool- arid juetlibatlon oi other detail: ‘bu, mwmm w, 56mm)”, “mums, with meumneiu m. boon added will! to ‘the 311W" ___-___ played undel- the dlieetiei. oi Mn]- . um '. m 0114! at committee . y“ muted, dition oi the cglgly. u“ °1 1'1"’ "m" 5 ‘"1’ m- ' ' clom Morley a ieliow countryman .- V [uflwdh “h” “T15 “M? "l, O! the Uilfllfil. 11T- m hw“ Qua-h 100mm go ; iii-r mUWTl-h 631d 11° 115d °1l1m°d Journ 9311118‘ who adjudicated at the reglorlal qk", m . uum._ %i.a . liwlhm was Roosevelt q fit la honed that _mmum d “ma,” now “ma. Y the area for .21.]: Unitetg‘ Btintosm In Conspiracy Case mum. he", l”; mt y”; “w- * l mo,“ $55,," “n, b, M" "1"" l“ "Wu-mfg 55g way Imllid be eueeeeeiul but reel- Amond etliei- eeuiraeis ppinwad t)" ‘if ° ‘gay m “'1 1°. the Greet Wer he had played to T8411‘ Wolofllfli mffivlfian- ‘h? provide 1"‘ “w” w“ “m” “d 111° 1" 1" w“ m’ 3m‘ ""1 “mm” "rm Ills: ‘gnoouldcsee tomb‘: tram-Ax _i_%( -n-e CMMM‘ “W93 m 3818mm’ m. III Faotomine (little nine planer. . w %mvi “xg: J1u1$fi"1;;m§“1§m who w,“ 71.30 a. irom my position on long. 1imlnni-y heir-lanai! Thogrzias P: ndfirdméili-iliitiithexpecis to oe in 1-,- fllhi v kby rive little naunilon llihmdhlda was’ w.“ ' on”, New, b, 6mm m, my“; h" m,“ m, ‘n E and . .. . I could eee et lea-st Slettery ei Saint. John and wii- oi... 1e. three months. ed- ':.Diaioalie'g aw. .22: ‘rarer: -....n=1'*r...'“*m""m.. .. i... "our 1* r ti“ “° "i" °" w" "' i“ testis-elixir roost-r ‘ii. “h: i. ‘the , ve. by avonlo out o! e "tam and m," an" m“ M?“ the m: ‘fim,“’°m,m°°"‘h,°§{°"£§3 on o y; "Ilfnll this area." Ellsworth 000 liquor seizure on the Moose‘ 393111.35 ‘i111: tel-XL sidflfilmnnhivi...‘ i lotion by w navy iilanol " estimated m, m, m“; m, 31?,’ wrote "mt a lrlouriio‘ range or a mm m“, neu- yme, l”; g, l- n; ‘M c; 1' M q-o,on’w_ m a _ m‘; 5°1° "m1 311*” ' " ' ‘ 111i‘ ‘m. -11"°¢"°'5°“ no eonaimrronnias gayest: an: event. it (Eur-r: lilo!’ 0! bl" 181141 511W“ “"45 ember. was adiourned until 1pm. wifiegriot Zfiifihesie at the Domin- i v i"!!! not actually more h m. 9min.“ 9mm‘ on ‘m. rm m, ma" d menu“ m, leaving the coastal belt oi hills. 19. Five witnesses from New pm “my, in lgndgn, onisrie ~ Wri- - Mo» i .. . -.. . "We-ii. .....s "*".*~"=-..... siinwtilierzlzxo Jifl"; “Kiwi? “r: "trit- limit‘. .i.°“°°.“"" ’°.' -- . - . ,. , rs ciea... war me a er. l "W We 6h Dro- . u revea e name , ' , h... m‘ ma“. committee o! _ om‘. servants ro Undo: the iuesem eyscem pur- _my fllsht o! dieooverv mlaht in ioction oi the court. oi the ‘kiddie. desired for the w-v-r slug e "reborn. Headed by Dr. chases no made by the notional some years hmoo hooome snow- ——---? nemiuim flnllg, m. siiiuau said 1 i i ii. upon-secretary oi deienna deoariliriont. subject to wand disclose rich mineral de- U. 8. NAVY MANOIUVBII but remarked he was a man very recommended creation oomnimee. The non ‘plan will surfaces show Jnueh evidence of WABHLNGTON, -(OP) -'lhe eimles oi M1,. tor-deniuiinelitiil oom- make the board responsible ior mineralisation. United States Navy will naelnble while in Charlottetown I‘: P“ ii.""...3....."' "i1 time": *" arm"- "w a m“ " ...:‘".........°'““'*"...u..:.'.*“'i..':; “J..'“‘°".‘.'."‘.'.Z "i on..." “i” i "' "r t. titer-madman: ebm-uiveuiei will mJ.-H.1omhu.ne.-and'r.n.eipirsieeeitduuivrzeidgduuaieiunlainliiteeiieveaudln. iwtoawaenlilnlniliuilotioiied. cilwiinntnebllliaimoidireaii. nutoliindelanfrflenoaa. Paine. ___ m; O. . IND m. external affairs. Nil-S IWNWII by the interdepartmental 1°!‘ .0" a" will 9390551 -—--—— prominent in English theatrical “mm! m .