TIMFLY NOTES ou topics ' - s.“ oat‘ F" Sh" Attfilltillll Fflflllfll-‘S "93? toumecrco WITH , ___ . e. ma... ' limited .2’; .. o...» Charlottetown date, government Ina . ' . ' ' The Appraisal Season for 00 _ - 1, 1- ,1111,“ 1,, 1,; ,1 1-. . Sflvef Fox Farnung - "mi" “m” f“ “m” T“ BANK “FINLAND he h‘ mnummt ifiwthlolee” f: I as bilahol. Mae we a“ ‘Zefiiostffff: for‘. aiid we are in afiiltzseiltignul" “om u“ Cmadian Farm m" muwum‘ ih“ °* m” poo o: _ very 1mm“ e number oi.’ customers that we served last Loan Board commences this land). kn yioiolflllleoggwdlxioudhn {m nmgeixigznénon ‘oomhol-llls 1 o Vextila. aerve in: same amount or fortmzon . . - . . . l‘ . . - - - Gooroo o’ voonoock’ ou,,,,,,c,.,,do_ ooo,.o,,,oo,, “on, ,5 mglrded u year on April 24th. n o... o"! 1on3 irirtory and doingntiuo en auob gogmtoxrie munno manque 00.. urn yea orders for feruhzer must be in within a few .1," Manager ui_ trio l-ur Mtu'ketiii|z_ De- ono of the most successful conser- A plicafions for loans ifldlilflll. —Cvl.llrdlln. April aa eiieslililtionaoh I J ‘t i l] ask for your cooperation due l0 the fact artment oi tile Cdllfldlull National vatlDn achievements in P _ i There co derable lucky day. en do o m . mo, o wmoh o," h“, be", M, comm“ and we espec a Y I h I h e b“ o o u‘ o V" F” Breed”, Aéswmum" mm “ppmxlmawly 100900 should b’ ma“ w u" un‘ ‘round’ m u“ mm ' t m“ ‘M mu’ ' ‘who "w... her the find athetie viaitor that on account of ill heat . av n ou o e office wlo expected home last evenifl8 from main in i908 the herd has increalfld dgrglgll¢dfi— odd title wan elven to the Bank men of inditheore u. P a . I . t continually “M. tho n", of January and I ha" o. a visit to New York. where he at- 1o net-i three inillion animals and indirectly by reuon of a. pitlable dlflldlllllhbfllk o h“ u‘ o’ h" A" INGLHHMAN.‘ Tun“ l moa time in u" next three weeks for tended Liie niile oi l7,00il_s1ivgr and its vni u estimated at 1100.000» J A LAWSON occurrence which took plaeo there '11? “if $11M“ gwonoymvo go to Montreal dome 1m. . color pl SIIVE1~§ heirl 000 . . v in thfl year 181 . min . i‘ u u“ Bonk Th. p-roh "find ‘o Home other oporoflmh 1 _._~ . . . Atthtdt tn t .sh celled , . George was suing} up ‘m: nilfr-ifét Under the ternu oi‘ the treaty the Provincial Supervisor, guhler’: oifioee rm ding; mclelfh‘ day’ to uk: "It my brother Arthur: nillne ill" PM We see no daylight ahead on the turnip market. The tendencie; and getting {Hit hand United stow, government ta true; (jnnadian Farm Loan Board, named Philip white ead. mire- here today?" and to‘ receive an; Arthur) on Thunder Bay, and com- outlook of tho potato market 11,15 spring 1s m1 a, n, , - the oecond part of the knowledge of ille trend of prices tn tee lor the Canadian government able in many rupeote. hie com invarloble answer. " 0. Mill. menwl "‘.?."i"1"£’“ .:.*..~.v:t~..-.t.:c::t .i‘.“°.ii.°.2." Ciirivii-iov-i- P-E-i- iié"....‘.'.‘.2. evil :2 .: ittnh 2;‘;.’.r.'..'.‘f..2‘..f..“;‘.“.§.‘n§ was; psi-t“ “t”... Mob“- VP C fifn .11‘ t i, - ~- “ ' n I ~ Mw-w“ '-'-""-*“'" ‘it. hi“ attu- ixt $“.’...§.“'..... h-ofiii; “i m":3:.i.i.{.'"i: i‘é'.3"‘”2§’§§‘ h: Frank B. Clarke l1l‘l‘l\ ITCC Y1‘ 'il‘_ CUHISIUIICQS hav€ BTBQI] TOUR] n0 e fi u _ ' , ' ' iimzu. urn: ill Nvw. fault oi the Department of the In- mango moo owdecwo cynoum llll “l0 dllllfleli $0 which this was viilil call‘ tt$0rl&W-l_l"°u¥§:n:l°bl¥c': {mill§oo§§§f°m§§5w9"'l,§f°o§,§ w“? ‘vhhth msalies sghgcfiiiresdary 1g; which “We” "sembm m‘ m" fieifdimgyechlhstdahglgfid i?“ §.‘§§."§nt.'°..i.§ a black crepe hood. (i872) there are one o'r two hun- i- "-i -*""" , D05 Done c ac ' 1 rance. ' r. -- i- i1 l , to the will ti! Sufi‘ "IX Monday. April 24l1l- The drum" ftidiirveéiiii fir? benrealtiqyfilflwll- F0 um“ is “i” youth w (f ‘t. NT)“ 8352?): :3 cahredfihgoorlialhuef §§§§dro‘é'"iio?.° goggongg ‘ill-lag?! ‘thunder Bay t0 Shebendowan He WIXQS-Ollthllllastih over the -:i Sitltlflvs lIl illlll_ (“rived "m" the led by mmrcscoplc examination of “W15” ‘he advufx-mbengo ex. ifffie.» an object 0! ayilllllllll’ l" llfl Telllmed H"! Y!!!“ 1R!" l" Lake. fortv-llve miles. we drove ill .-rews, Iroquois and Ojibw-nys nmo om. Mm, {mt ma,‘ ‘Kmatmédgoagcdgo scralllllss from tne cars 0f infill"? ',},°§,,°JQQZ,Z?°..YQZ§Z° 0%: “neigilr? ‘the city. A group of bustneso w “ would haye found a population of (m, do)‘, ‘in ivaggons light flllll bcsltgl V05'31‘¢I3l1l'51kil0\‘in; no dim-- l-_ _ » o » who, .lalv°."lr)o'so,oi m. ‘,,,“,,‘D.,,,,...,,.,,{ foxes or by tciiewl lll§l’°°“°",° h be offended and threw up .._.- o small annuity and 14.080 eouh; Canada was srowltis heavy. I _ I o Dawson 109 llg-lcelliliimoed mcii as out] ‘F: w", “. . . . ‘ N‘, Th1“ lhtooio? to omson“ “qfl, ‘(he the eat‘ Calm!’ W391iIIIMhLBLiOIIVl/iliil _ He began to gamble relieved hei" immediate ncccs- up _ o The sewn“ P‘“t_,°e ‘as mroo glacial? d? "e t" r95‘ °ll- Dunc- *,‘».‘;°*‘€"o o 1...]. HoJO. ,,.,,,,,o. f: o Q,‘ oomoomoooooouoo m, the mile Ls severe. ooorsionta v _ Stock Exchanle titled. it was observed th t .te As an aside he notes. The ner- Road~tlie iatcliriirll tin-s long and use. l egg‘, unkoiO-rtilllalnltix. and o‘ B“? c. L‘ d o‘ ~ i {hm 1, fltmam 1 t“, whm, 9,15 Wm" me ‘nlesmmn i‘ navy’ 8' and became hopelessly lnvrF-vc went to a certain chop-house tor sistent loyalty of Canadians comes hundred and y m c b 1.: o re: rv ng .5 o o! 5119,31,", m. “'"F_."l, “W? “meow” ,o,o“og,_ sue “p”, meg“ too concern,“ mime m“ l“ 4°" Wm‘ mud“ e“ ofthe fact that forgery restaurant; every Ody ror dinnei to the surface in the names they would never (he thlnokst n: o so their "canoes. Further on §‘"o°“‘§l L°.“°‘§°§,,‘ e615?“ me=tliig fllimmelnflrf or fife difficulties "l" 811m an animal m“ hi)“ l“ we; e. crime whose punishment end the euatom arose for eome- give to almost every newimtle- ten by the WIWJOXSI m” ma: says. t“: wallet! easily tinder-stir... “t,” foi“, ‘Ron, ‘i, w.“ for], e 5°" ° ° (Se I head w one side and mm m m‘ wee death, he forced a bill on hla body to come 101F511 "l6 l=llll°ll.m°ll¢- The llllmhfl’ "l vcm’ 5,4‘ “"1 Pliifiwruko sooloossw‘ do o m" ll, I 5 "l Enililhmhh $31 ilet n’ T. ...'..~.<i...'.‘.. to '.-.“..-. T1, Ounwnem ma, [he mo, cles. or shake liq head and att- old Bank, was arrested. tried, and the honor o. providing her witn a Prince Alberta. and other! m“; have emioyed I r d ‘as our": trav; driig o1 weeks tooether with ' “Ff " Ff ," _ T W, o - , '3 3m‘ o o o,“ mo, oobtempt to scmtrh its ears. oxooo,oo_ o, Novmooor mo m._.,,,_ - rdmiiy names already n r the motony o wit: 5 let an n an guide invar ably rent §kllhl9ailioliloolloivt‘ cnli-jpvias lrllflofilltmt" mt; m) t 35mm“, Begum,- inspectitlll of all ranch ms sister Boron wh,tohood_ o “mo oossoo on m, coo do‘, Sh, north-west promises a good crop over the ivater-sggee dognencf. tracts a personal feeling an“, gldlutfitgg irililgtlilc; Efitiitouii“ bei fight-e nidlguythii": iiimycarscsivlany of’ f°>1°5 “humd be yaaoioziigrmmi‘; girl of nineteen. whok had been was missing from her usual haunts 31o stggllfnufligoléi! ang‘ alégg-ya';figflrg'l gggofixgffstand e e s‘ ‘s u hglhoglgo ‘réioxéqfizlgootmonghial all! . . ' -' ‘ “Y. ill June “n t, hi3 h E l‘. "Wh i5 Cid L d, {Tl ' d- ' , . ' ' In Y. 39d bu}, s5?,',‘.f“ “fungi; £053,135! ‘"°"‘.““§‘,,“P",§f 1°25 gxlfotamtesggrgg garmites and fleas and more Vfre- ggolgfio‘fgoc,,m°gie,hfifi even: mdf§°s,,§f{,.. o1, “mu, en,,11,,e,?ed_ However matters are not as bad‘ and rhanoea Wxtleiffolllfk?!‘ igv: R18 18113111!’ 0! l'¢5°lll‘0e and lei.’- e auctoii u. scone o . i“ “m5 c“? e i.’ e ' quentiy in individual foxes where m ooosldorouoo for he‘. you,“ not knowmo mo“ ohm, d,“ m, ea he ontlcipate. tat oms long. rag e o0 n3. u forget! nese are admirable, ",4 rostrum nilri mid ~- tie are 201111. wont home Just B! ooon as they . h been foumL _ on}, cgffled nine or ten men -- can 1,5111”. 1511 go w“, m on wuh tho t- drshito [hr inH could get the necessary reservations. he?“ glfggimtofogf ofiftos m mo ox_ Vlglclgoflghgoxglllgllgfdpfilfiipillfiaglmfi tltelllllgamlgnldoegaoon 1:10 teligoggngihitl: _ six of mom orowqmo ,,._,.eo o, Sh, _.. "lil- umnunn by F)?‘ frlplitls‘ ‘lzlflligllltlétyiasiglofillcigiiy CtEHIiEI-lilgthiil‘: mm“ c“ “wily 51v“ me w an fiertaken a 1on8 Journey on behalfithg Bank in Threadneedle Street dismisses m a‘ 19w Words " “From m" hundwd pounds of luggage" ‘(mntmued o“ Pa" 14) ..T"§..‘~“.‘;3f“§‘“... is” ...'L‘f".“ii‘..“."i’£.i§ an: :z..".;tt.:.“ii.r::"::.":.i: Eliot‘??? o? iiiiiiiii ‘ [i5 Tl v3 C n O was the last important sale of i, eventually held. The trade wna gfimélso Yogtrufiwussfigfeio ‘e122 ranch mink for some time to cume much opposed to the action in ohlok crusts and “M”. w“ ca, es- I and that ceilings “We mt booked tablishiniz the ceiling prices for Al- w, Show‘, ton high on the btrticor gdnds._'l‘he aska scai 5_kills on the top prices es- fogl°oofliififl§en§nigsedgtioy means of 1015 vwm well ‘(lliiflbiliCd _a0me tabllsiirti in April, i942, 5819 mom {omens m order to mow c“. observers rctnax-rzcti that LhiS wrso -_-__ mne 10mm to goo at the mnes‘ an tjxillllulo v.1 what would happen. The effects of the above on the which mo under these scale, 50.1,‘, in the future when there is fur market Ls not good and all the ronmoors “no, sexton,“ m, 5351a,, extieme need for mercliandl-w. fur publications are carrying lengthy m, namely, that, rjegnrdles; of oonseq- reports with criticism of OPA. It gflolfgegjggsffnowfigflflfi, $58: h‘:1p_ uencee competition would be keen seems to be a case of too much nf- ofi,‘ The modmno Show‘, be “C1,. and pricp; simllg The throat of ficlalclom throwing bilsiness into a m,‘ but morouohb, rubbed mm Q11 OPA action would hzive little deicij- maelstrom No dcubt things will mo tissues of “mo o“ cavity 9,1,1», rent cites: rm a hungry mnrnrt. it be straightened out eventually but the {moors or by “mans of ,1 com,“ w“ indicated. icsl. géiiing npportuiiiiics can never b T115 t 1mm; should l!!! be fully recovered. $3,“ L, “$63,, doyynoluooo who; - . The huiznboo. OPA. translated The general opinion throughout m2‘; kglolégmn{hg°l§fiit ooélcnuon means Otlzrn nf Prirv Admthisirat- the fllTlViiICP is that this season's om, bQkflrP they have. hnrl time t-n ~ ion, an arhitiztry lnmi-ti sot up h.\' prrtrliiviim. n! silvci- ifl,\' will be U , 1,91 1;, the linlrerl Radios cnvr-riimriit Ii smnllcr iiinii iiuiul That is. tlir adult “M? and g“ ha; the fur ili“l't‘illtlll$ 0i 11H‘ U. 5 litter-o arc stiizillcr in avcrzige and . . - 1 110,, pommccd n1 A in jitters and is the hrlmaiflvJhere are mort- niisscs Of course msglfufénéifnklc pg“ Submocd man“: _ , ., _ t fPt=‘ Iodldcibart madkel. that 1vrrvaiL= for siiier ins. rule and we are glad to state that @312‘ some; Qfififl, pa,“ o; 11y. in Canada with pogsihlv the ad- Wlifrod MacDonald. Covehcutl, has .» _ . dcri effort of loss imrtiviwatirm by a litter of eight which contains noun?’ l1%ibo"§o‘h.g;“g? ggrlfineegeg, ' Smith American fur rierilcrs. live pliitiiitiiiw. ziiizi tinothci" lifter ‘by: ‘Liooomon Exporfioonm] p0,, . v _» —- ~ of seven ivhirh contains four iiint- Rood,“ ‘ . who! Miv loth iinirls fol-iii for mums It will be rcnicmbervd rlrnt Iomyoorme ,5 unob,o,nob1e_ o 1o_ cause for the rnmpamtively quiet there are always exceptions to any us sill/Cl‘ Inx farmers in Montreal e the first pelt show lit-id l - ,,. . I -1 :a...".."*.:.".:: i2'”.’.§1.".‘f.‘.‘.‘§.‘ its. W‘; §.i:"tt::“".‘;i- ..‘."“‘"“.t:t2" P“ ill i"vii’;‘i~itii°?wi°‘iii°’“iiii '. . c . w e gran mp on. Will be compelled sooner or i)atei' -_.__.. 515° be "m" Wm‘ 500d em?“ to ta! lnwr‘ nrivrfi. My anywierc Char] ttct w ii l. ' ri.- .. .- < O lwitvcisi l0 afid 21 poi-cont. in order lighted [in 13H’? n} $111151: i/‘iglif fzvifn~ ,7’ “f” 111x131»?! in mow» ti.“ quantities or siivcv fox J Wilfrcd I.ct'k_v. Siimmcrsicle, on! ' m‘ ‘khlftn, n ,1], 1,,-,‘,1|,e,. 011. pow i-rmaiiiiiii: unsold Ii must Thursday, Wilfred i5 one oi our! YVCRICN;,IF__ so‘? gem, a member _ e a be ntlmiitod that the market hntl best. ranchers. modest, tinassumintz "i. mo A F. woo mo, om". - nttaineti n very high avcra"e—$45.0il but yet producing the type of pelt o t 505b,“... or", w one o; 11,9 r p?“ n“ m? ‘Iamm-y l“ 1W8 year finer "war m“ "mmfillds t‘ gillldisiililfln centre; of Germunv < hisnior than rvnv time since 1931 good average on nil occaqntis His Koith had boon hflpmg “cum, 11,9 and nf tour-v- flmlliis n!‘ a GCCJIY.‘ fox ranch in (‘lip of the largest in . _ ,.- . 1. . - b“; 11k d P F d‘ ~o . . . ‘ _ tho Maritime; and is a mcticl of ilsigfiffolirtn. joiner? t - ,-‘ ‘ .1 w‘ Cr P09“? “mummy up for service in the air and was lion and cm lllgr; PIICC. It m Kilt"? - _ --_. momy ohougm of om, a vow-an en be a 20nd th its. because i! t. c- DI. c K Gunn, who i; indef- o, many o“. operations’ To 1.1, . ea are continued on a high ave-raw atlgable in looking after the in- parents we together W111, mmy i'.~“'°.i§‘." .?.“.‘.éi...’.’l° "’."3§§.i.’..§?‘”5.¥ ieiiiii ‘l’.vifitri°fiéidih$raiiifdi3f "elm ""5 “m” °“' "W “"' - - silvri" fox tanner: with the rctiscti- cars below . . . . .. I ' ' Ce" SYmPMhY m thelrflejt’anrrcw ' {hi5 115$ 0f IWITdS it [ht QUCbCC iicnrc that nftrr the wnr 01' ncr- ‘ ham mo... m. war i: ovor. there vosrnot. rw EARMITE "W GLASGOW w- M‘ s‘ Show wori by Harvey Doraty, owner would be a vrry serious break in DISEASE _ l u, o- o; _ ‘ prices m'§“§e,§,°§,§§o$,°’},,f,j's‘f“°,§,§“f,.,m of Avion Fur Farm, Old Chelsea, Quebec, '*— hi’ . . . . . 7"" "ilbll" W“ "i Aim" "i1 £2.15‘? hm“ o x M" Mam M“ ' and a director of Canadian National Silver Tkolflsqllflr ih: hoflffiilqfxlifliiifl‘! Uri.- Pr: _C K tiunn. Superintendent. The Easter program 1n the mm. I _ _ mh. hiiof fll.l‘llill n_ tat c1 cos Thniiinioti Flxi- iinirntnl Frix Ravioli. mnory monthly woo followed by m’ Fox Bfccdefs Assoclatlofp A; [hg ghgw h; i?» Qrtirii“E:n“"?;al€lg*l)ll;'ll;% bivcillltsé summemdl P E 1' “vmmnal leadennlflsffvJiMimodi h'bit d 21 f0 H won wanna our " " ‘ ‘ ‘. E i Ed i t fig I'll O 5X l C XCS. C action or the Crovrvnm nt thioneh Ear mange or earmite tiiwase in ohovfiloxg? 313585 6,345, 8155,15“, ,°_ an OPA orrlrr "Flue t ictzr m cl- fo es l. r it.‘ di. hl hi _ rlrcsdard to C-rlnnel Fnifko iahv fhe witlesplgdninmfliicnarlqleagisefgx cwtnf 1§'}’,,’,§’1§§’§",,°,d,§§ fikssiyrfbptiifiierelesilsigg DPPOURanANncnAbnloNmlpsgtandcham ivnv on nld frlcnd cf W ChNVW‘ S. chcs H. i. rarely a fatal condition . ' ' ' ' Mrl-iurl TP""‘ "Will You nlcn-‘e amour! m?» fllllflwifi. but it rihvs Acgitxhlsfigofi; ffgzfi, lgr“r$g3,1roc,_ P19" sliver! Brand ChimPlon Platlnumv nirke tho rollnivliv rioirniont to an inimrlani l‘ l~ in J. d1 ~ tl u t- - s » tho tui- trarlj Y‘"t'.“"‘l‘i in =t ‘fouls "rowih of nun (ford-g oifriqinflind‘: gguréseqiirtgrrefisivegliilildrggnglffzkff grand champ1on< Pcarl platinum)’ Four ‘rho iwsitiuntiwi of "v3 filn=k~ [or trenr-ral imthrifty condition anions; ‘on, members, The devotional period _h . h. E. htfi t tho d meal hard b) th» Uni" Stnrv Prliiii animals o.“ omuoho oooolooo by M,“ Mo“ . ampions 1P8. 1g 1'8 S, 6C SGCOII S, government. unier the terme n? or! ‘Permit; dlnrue 1,; nguegg] by __. soevonoon who “no owoofly “Now _, , —~~"~~ - — r ~ ~-—~ moyhowoo mo, m, field... new, our thirds, one fifth and one seventh. roll ohdifwlififrfi?’ rléfii’ ‘.3325 Quite a record anywhere, any time. " scripture. After the minutes oidinst , - . - - . e . ggegg,gvcgiig"gld?,ofl “1,’I,Z€§"°E,,o,‘§ Harvey docsn l: believe in ' luck ' iri ofl"',.l,i.l,;*,oo’,i,g;gf,il;g°;,,fi,,; Emu’? the successful operation of a modern fur Mr. ervyi uiman era . . . . t I ,’ anvil) slrn lnteilcsfiiizitz ‘rlcaltiing not; Iiotw farm. H6 gOCS It l! iClClltlfiClily-llld . m-ri c.n"_ vcac e ' re r es elm - . . ion in cifin... 31.1.1; lwlosbfolllowegloily it shows results. il very lutercs ng p c c ca e ‘e ivlrott mum‘ buyere oi Bray Our hatched are un- Q13 “induct”! by Mm-w3-Blllmln - H‘ A‘ Dom’) ‘nd L“ Mamfidd- ' lie m. s... Hatcherlcr. u5u3||y 1...“, m1. . w. W.J.Mcbe0d read an article on He attributes part of the success to ob m‘ o, .0" m. m, r m our .- in. . - ., - » : e a. _ a , i - - ‘iwcrv gdsnn. Hglcvs Dart ‘f’: Rlfctiim. ‘Olson’ so. In an“ émw tfatgfalsdgefi oi?‘ gxvilizés. glelw DIN H wfibCi USOmC 0f [h w p t’ p "u," Ofil. for itigtanceila“ \ r“ m P loarfo ...i°.§$.°e"."‘i.'.'.2'f§ 822%: and Mi: W. ‘ GOO? FEE G c c Um”! "Wmpw" “l” n‘ Qwb“ F”: o _ ings. We may lie able Devotional Leader: qgdit 803 [0 you, 13 W: have been Sh,“ 'l gnust siiv that Bray (fhicln. are to silpiily vour needs McLeod. organist: Mrs Foster bSeIiar. E T f d l f h tlic rst Il ~ - h ti. Th iirom l.v . . - u- Refreshments Mr Fred Toom sand ' ' - have lois of zfhsrvlgiwr." 0y Infill“! ll W" Ill! Mrs Wflflli-‘d OTIS using H XI E cc conunuous y or t c l" i 5'9""! "ml" Roll call for next meeting to be ’ Am, Mo, o’ o. ohooonooo‘ Two ogtlireed, grade, and mm,“ Wm, , W,” o, "Mo" past 4 or 5 years. We have found it to Adi!‘ Cims. P. E. 1., “IHOS- o\u||‘£elo|£|5ewl;hap$f'tili:i 71,221?‘ owiiiffi; fiigrhvi}, b6 l. well-balanced 111100, giVlllg H i "Out of the 54 nulleis I have ‘kl g ' I'd m prayer- Moe“? ca“! y l f h d ' (h l- . . _ . tin th Lord. Prayer end P CHI)’ O ‘TOW! Uflflg C 8 OW {l8 unis '1 53-. .l vrrv fine nnil healthy . _ 5g?“ gmldioflm To Unkonv " 2mm; W" lwl ii W til . hum, w... m“... by m, ha...“ months, and then putting on fur in m’ l pm." . ' d n _ ““ “mm t the months previous to show and pelt- Wheiping time-when the mother fox Calcium, phosphorus, iron and potassium m“ mm" m o r -—*' M needs increasing amounts of food, until iodide. I ' ‘ . (ire: afllffl! S rec, ‘ aro eowli I _ u. Franklin Brown, ‘o. o. 1......“ the gets all she can ’ clean up". Time to New London 3. . wm. curtain». . ~ increase the cereal supplement to 257 .. Launching A. Ie _i__ o . ' _ o ortnrrotronr. “gig. root. olit/lallclmoleuttgnahlatasontg; 3 . _' _. of the total feed. Tim e why the n51» I 52:23:‘? &:.".v"i'..§:.""- itzsfisti.:i;tsi.‘ilt'htevwiit: - ', ‘W1 i’ '° imvoivtm- YW" l“ 1M» giigqgy d ~...... "cliwtmqgtgggg- $51,;- - EX IIIIIIO Gilli: ~. owl w know rim HEXITE contains "l"! BY l" time" - L Kllh Id . . - ' ' ' i . . . ‘ ' . . moon. m n lgsiz-elclrltlllt, r I‘ 311,333“ “h” "mm" "ml m" , I Kenna‘; yo; Fwd, i...‘ 5m i, 19 quality ingredients, scientifically bal- na on ngwe . . . a c on: . I ‘ -- . . M ll S|."l 1' dl c". .. ""” ' . d ' . ' _ nooanndrhourm. “goon. “:3?” Mono Moo Dom oohoooo‘ , tested an proved with many anced and thoroughly cooked. The lll . . ci l-bel s d ith '~ - , . . . iI\'|‘lf:“/{i'll|‘lllf|?r.|. Enmmn Rig‘)? lllnrKav, M‘???gsihllgglgllgpflngl/llcgvnfigll.‘AJ- ' Benennons of ‘oxen The? l" grcdlcn" Pmvkk vitamins A! Bl (or New an...“ ‘ vim no"... Mflclkfll- backed by the nutritional knowi- thiomioo) B: (or riboflavin) ooh“, f“? Lot i6. will. West Mm "ml Mm llllislll" Mul-‘Pm ' V’ edge of Kellogfr-worid’: , ‘ ’ . - . - tors of the Bcornpiex, D, Eand K. Protein. LONDON, ONTARIO I n: v (iiiriiiiicr, Garth Mncl HI". f . z u, v .._ M q. , _ i Bummcrside. spent the weekend in v .l. ilzrfrrv (men, n g r n n Montague. guests of Mr. Macbsaifs larger: maker: 0f ready-to-cat l! '. . .- r-"r- < ,_ ih.M. . U.‘- . i-f.".‘.'.?l.7'FI'r'r'I.'§...... 5 n .""‘"".' mrlilllsiirI-Iclffi d"...i’if“fi...ii.t.roror. , a cereals. . oismauroits roit memes eowano ISLAND - i 7U. irl. '--~ i»; .. i -i M's, 'r.v. c. t. e e t , Flat...” T.’ ..‘.=.1.."..... ;il‘.....‘.. o......§€.2...‘1”.?.“ '° " DOMINION SILVER rox runs. no. CLIFFORD MACDONALD .~..n.iiu. "Wm n. riivi-Jamit. - ... ESL’ as. t..."B'r. will." ivwi. !Mr,'....“o“iv....'§..n. p£i._"ri'§§t.§§§ wit. -.. illlllMil-illll cimuonstowu Brmililvti. Kliin c». wii~~i Valli-v 1 returned Tiierriay evening from a , trip to Moncton. —0 ill. BINDIN‘