PAGE POUR "l'r' _ ‘mrnsrV'Nnws__~V V moulin, frouno and G Dudley wright has |»resenti=.i'Thls was Grace Church Pity. (R.-v. lllillnrnfthe count Harrison, pastor), with .~ n-.lul..ul_1nar|1 for a rnai-his haptierunl lount. ol the vulue was built ol $76 This has been duly acknow- 111011111111. lodged by the officials, and is great-illililllcr an l appreciated by the members. Mr.\b¢11t 1111811 right is o nlenner or ine. lnli-st,¢w° store Qhhy-ch and in ap _-._ from man On Saturday, 17th, at Cherry Val- 10W yB11l‘11 icy the death occurred oi Henryl Wright after an illness of pueum-1 *T110 th onis of only four days. The deoeas- District D ed was one of the best farmers, and Excelsior his dearth is greatly regretted by A Valley on large clrole of friends und acu,uain-‘lW- P. P taacea The funeral took pina.-u sun- Ollltnrn Dr dgy evening and was one of the lar- Profltt, D zest ones in the locality for many Sentinel- " pro tem yn ___ D. Con.- Cgptaln Robertson of the Salvution 111 120111111 Army in Churlottebolvu. received iz -101111 HUW telegram Saturday lnorlling from R. Miifflllllall K Brace, who is now ill Sarnia, Ont, P10119. M which said H0W“1°d'- Just got Berthn’s body at tell M“|`C1111U-ll twenty Funeral Sabbath ut tllree‘Pl`0i1it- o'clock 1W0l`i»1ly P Later in the folrenoon another des- ‘V010 0Dtl patch came to Captain llouelrison ‘~'11111nl1l@ from Mr Brace, na follows:- 6 $115500 ‘ill om Dalsy's body recovered. Cnn t F110 10110 'take home Funeral tml|o~ri'ow. 111130800 ..._ Evening -The marriage took place at Eg- Shalnroc Bay On e nes ay ley were in 1, at Hunter River by li large crowd of ‘°lii1Y 119 e ll ll e in blinks P1 l .1 their new ome ri yn cr l g bled to cougratlllute the new bride"e1"1y to d V }'rofitt an groom Marchba 'Q 1 V? 1-r' u - a ~, ' - _ louse.of..Iohu I4ckey.- _thlf m,i_liv_ ,_ ell Iraiiiogtarif _ known' an the lan-li larginws 1m°ll'¢a 1' new east of Summerside was burned to Sec' of the N B and looeoewvwooooooeooogl -rw-any mason nu cvullinr 'rue ymvlndll the §£11n¢IlV.uP0;rqir 1_0- Zark of' Suiru-1 Asaoiciation, gave am d}aco\lrse ‘ _ mer w e vu 0 ' - asus 1 #eel for Sallrday observed che ere, erflve t1<1>'tll:°hl£:':l::ili:h:ilv:y§° gozlil was ll subnnberm xgugalxhrihe Exlaan. Mg. Lackey and bet!-cr than usual, and was . _ e ouse at the precknted hy the congregation. - ‘ time. The fire started from a defec- meetings of the Eldon District S. S. _ tive flue. The nel hhors althersd _ Uh wh" ham in the . gh"-hy B., ethodist Church on the 15111 July and in spite of the ~ 1_-° at-' 4 °°"'°1lP_9n¢ent_from vu., inivsr Midas. rattle 'rho °_n.'_'1° ....°1ll11»¢cl= of '1‘rynn.' » 'um 1ll!'.Q.._¥|°_.¢1\-.visiting Frank owunl,` _il°°_iP!»» ‘1'll1‘nts\‘_ River. mg homo' .Kinase Nettle 8 Z a Associarti saved all the moveablea. Valley H one of the oldest houses in olngteohgh y and stood as a land unfavor-51,1 bout one hundred years. It ¢¢nd¢¢_ at- a time when lumber was hi,-ight hh The frame work was all of dinghy'-hgh d the boards of Dine-of the new Moth ty' It W” “ 1‘“`g° “‘l"=¢° Revs D. B. . . Gan _ _ . _ y building with Mp roof “hh :,’,'hu§,,m¢¢h`h5h|»1hg_'»_[~h¢ hihéihz Al_\\lrc¥rl_,.¢of~ Oouegrd, pearsnce dldered very little ww led by _,_ A_ M5°"V Powhhh visitingl thairgporbmg y houses built in this pest V __,__ ° _ Andrews, Hunter River.- Miss . There is $1000 insurance. Dr and, Mrs Murphy “nd '_hs“_VPattci:s0lI_' _ofjloose Jaw is -%- young sou of Tig.hh,h_ V were in towuihcr home in Hunter River. Miss home. and few 1l‘¢l 1l1111i’t0l‘1y session of F,.,day_ M" Mu,rphyVmd hm, sm Patterson will return about Aug. entertain lrieuda i.v‘iaion, No. 2, met withVmi“ed. the 0"" ummm on their fifteenth- Miss Marion Patterson, John. There were DVil10ll. S. 0. T. Wilmot mmm to P_ E_ Island and -wenlilhnrlcrttetown, is visiting in HunterV the ahoriglniea Th"rsd3y July 15") 111” Dridriven b hutoto Puhsgc Jhncuon R1V9l` thi! E\|8SlZ Of lie! 60\.\E'ill Missl D!`0S8‘llt. °l'°y ilnlnlilinnks Presiding. hy D, Bouyrque Th, Limiged had Lottie Nicholson. WEDNESDAY. ' ' 9110"" esent were D. Scribe-G. W. ' . _...__ » - . . , RSUNYV . W. A.-Wm. Howard, D, g‘:_'°;f‘€‘;_t£“:)1:‘l;11ll;ceVy;l“cMillsdbgsxoi-V;:;|‘:V _The danny meetings at Km, l-The following are the Alberton HU _ John Howard' Appointed ing the junction iust s the train was “Zum” 'Mt we* were 1“"3°1Y “V mankel' pr1°'°:"0“t“ W' mm any -T115 10115149' i“°"°"1' 01 Phil tml were D. Chap.-J.F. Profit: pulling out of in Eamon ,rhwlgended and were very enooenafnl `|n___ live cents.” butter per lb seventeen Barham was iyrolronlinto Tuesday IV-larry Waugh. The session- were hows” 1 d time 'orovory way, The sunday smog] gm, cents, potatoes ‘ser bus twenty seven high; ' ,hd 5- quantity of .lobsters " lite” wn1c=-Credcntin1s:- th L h t T' 2' fi t d or lierence held on wednesday afternoon cents. el.-zs_~l1t1» own sixteen' ' with relrnn. lt. le eupposcdhhal the lol.- lr§M'~lIilfi"y lwgulih' `f,f"“,_€“ pre Mllglllfy w:°§".,;ree/to 1; llurpileeemfe °°,§”‘ "1" 'fm °f 11'°°fl¢1 nf hstlnnr “W “'°°1 9°' ll* """’“2Y °°“‘°- stern .went with the whinkuy taken .1-eo rer:-.. e '- _ . -~ '--_-- --_,j ' _ iss Etta Humphrey, .Wm. :Tru “Edd-°ughi'°ght° b°t1°i“;’d 35° thi: gd gill; bliiet elaliwzmzlxrwqlxliswglldnrvg ~i-The iollolwing are';i_;e=§llll,lmerslde_ ,tho “leigh” house Ffateflinl visits:-James ° fn “fit 3 ““ ° "P 6° i lvery pleasant time was ’ spent. 'At lnnrknt Dricvsf-n-B_lit1~er vcr lb. 16 to 1`.~pli¢‘marrlage of Nell A. MnPherson, ks, John' Howard, G. W. luncl' °"' eg U' “I W” 1”” ° “`7.30 there was a, Conference service, '18~cen¢11.' P01-510°' P°l‘°11`l1B.~36 ‘0diitJei.~ |51. Tyne Vlrlley (P. E. I.), to Miss The report ol the Dintrlel 1°” “"1" '°“’*°=°° ’“’““'“°°- Wl‘i°1‘ Prayers woreeeld ny the areneeaeml cms uliydcu. ln uinip. hay looaeiper Hattie Read, einen .laughter ol wil- atriarch and District Scribe i”`°1""b1y is 1* "°°°"d' especially 5° and Rev. F. M. Webster and Rev. B. WD- fs- ill 91|`°W' 3450# 001'-B P01' 111111. llam Bend, Port Elgin, was solernnr- rrlillélf-lac thnd coliltailnedl niapy 3:38 Ul{{o\l11;’tol:'°q'~}i'in £110 W9" “°'W1Y J. Woodroofe preached an appropriate 51' °°'""" “M "°°1 Pei' lb- 20 110114211- ned last week at the Presbyterian s_ li 1-1 ons w ic wereds- -“ - sermon. Ou Thursda at s n. m. 'n --- . use that lace b Rev. J. H. ring the hours of session. *_* large number attendiedytbc celebration “M°“‘1°Y'“ °1°°l~i°“ Bt Lena” 'I9' llgpownegti Tilely will lei-lide in Port wing fm,-toy-rml vmth were On Friday, July seventeenth. from of the Huy 0hmmh.,,ihh_ A devotion. land resulted in the election of Jos- El in _St Jhhh vpe|egTh|,h_ Slgarr :Vhe Vchixiug quarter. Bvylenlivitft 0111113 l;‘V1,°l;l° °tlhB°11:l15VW ol meeting wan helu ec ten o'eloulr wh linfnniil nn Chief. by n muiorityl 3 ` ' .___ ' A 1-,W mm, uh, 1 ,,,,,,_,,,,,,,,,,e,, s Aberdeen. nu v cn Y sn nr nee ,nr a n_ lell hy Archdeecon Reugh. At two p. 11 °“Y 111110 with 0'” 011114 911111- Angus Menonnld, who ls ln his lo lry -‘rerun-a-liven." 1 look .eynrnl k to visit Excelsior Prince B110” 01 -101'" A- 1V1°N°"1“B 110111"-1' m. the Bemi Annual meeting of the Ph’ ‘1‘\’1“10" is 1111111- 11° 9°Y“ti"Y» “0 h|g|,ty.£,ec¢,nq year, and the oldest boxes. and from the. outset of ihin ‘.n»._ V-.. -Lge# store of R.E. Mntch, Grafton Street, and helping thenlse-Ives to the gunl where over fifty couples were usneni- 1'* Red'-“°i°“» Minh Jsssiv Murphy; was spread under the nbady trees, A correspondent from clinton wri- ' ,has 110:11 11PP0i11'~°1l S P dealers or from Bruin-a-dves nimllead *ET things therein. A boy llalned Mc- A tel Leod, who was before the court fol'1C1lf1tl1Hl theft recently, is nguln ill the tuils,1t1lBl'€ y ‘his-ving walked into Mrs. Chas Col- Uamero Iin's house on Mc-Gil Avell. and ex- Michnlel tracted a ten dollar bill from gl intries satchel hanging on the wall. He it is bel surrendered eight of the dolln-ra up to lcave t authority when culled upon, lluving Lennox disposed of the other two, Novu S _ 1'i‘h6gYork District S. S. Convention The Road., July 20th. The Field aec'y, bridge the officers of the District and de- Cimylh legabes from nine of the eleven'0f the schools»were present at the afternoon' Oh “rr 'sesslon, and in the eveling the church the ho was v.l-l. filled with those i-n'Lerrsi_e\l sed b in B. S. work. The afternoon nies- Revy ‘sion wss occupied largely with hear- C ie e weather were well The addresses were ppp- and interesting. by Rev E. Styier, odist minister at P McLeod and J B D- S.. recitation, Jn/men he cnleu-lated to nutiely the mute oi under the 'skilful management of --Port lllll, .Vluly 21th, loP0ll°_n~ in nneeeneion to 'lulee cameron, _ 1111115 11111110811, Rev Colin the most noted' epicures The inner M191' V1’/l`n'8 Bl'0Wn. whose school won man Phill..ps, Sununerside. Detliin.-:,,h,_,hh»1-gsnigngition goes loto effect on -Tuesday night some persons ti,,_,- Saturday mowing three mme boys ;l'owl;Vseir;d, New Brunswick. Chorus man being amply attended to, 01,1 $21.00 in prizes for drawing. Miss -1011. Mitchel) r-nl Mrs. Burk. '<\ill¢lV1V'Augun¢ lat. ‘Mins Conroy, who it is into railway wharf freight house Sulli- named Steele, hlclxelinu und ilroolll, fsildc 0 between the ages of tive ulnl ir x yenrs, I’ 'refi- were arrested lol llleuklllg into the 'Y cwlr' H1* ' ‘-hmsroram. vp’ -l lrv-" B 1-git e 5'-s= *- are the offieire uf 8 0 T Fndlerici quarter! W. P., Bcnlamln trus- was gow oppor- From Micmacs F. B. William Mer Bagnuli; '~»..lu., A. Cvud., ..l\cy, out end of No, was otherwise' no The--dams!! gndvghs WB! Zd`I'V0l\.\||* Aiiat ear nent No. A nl' h gine, was broken and hulll1D¢fl"“P _ill Q,-the centre. 'rhlu eaveulhe sus-inns from more severe damagill- N°l1° °i the running gear left the track. N0 was injured. There will 'h9 M1 and it Will tile!! 113 erred. cn_ opened, D. W. P. March- the hills, and the picturesque and' J. B. Mellish and T. C. James of 0111-5- 1»i1'i"~J_f lil” "*="l*¥ 1* im* 1°’ fni mum for his years. Bent this. liven (heh. meh S. W O 5 uw.,-,._ hm esVldlng. Following was the lovely 'scenery make this an Charlottetown, and Millnlan of New ’°t“i°°°' '"“"'f" L" “ignmim "mul B C0111- with rice and escortfd them to P;`°g1`11l‘l"- 11110113118 1ly]&11c0li0ll'. address ideal spot for a Picnic. After London Parish. 111 101' bliitef. aria" "_""‘hi': 3 n 1102* .___ "F'E§|1;°a mes.. and cu" wane" We » l. , we c , r I - » - n ' - h t 0 t Bhd Hr d 8 e ercy nrchbnnks, D.w, u short while n table -- tan ¢;§§5lo90';. gully UE 0 ‘"5 0 Misa Margaret Conhoygnfxagzzhogi a ,b°x_ 6 for who; may box hm M ir li Took r ~ In New Well. AM 30|. 10 Vililt Stirling. Olive 1111 lnfm l0l` 8 ‘i11y'11 Outing- T110 Women'a Auxiliary took place and 58°' °“° Lime ‘1°° will ”°“' WW' th” farmer in West River, rolled eight 1-l'@°1i111l‘11¢ 1 WS 1l°"°i‘» V110 0011Slll>l- an cured. audi nie 'elsefnurge' mont. Bay Church, ou the 13th lust- Wllllslm I hh; hy Rev 1.~h¢,h¢fB0udrhy,hl¢' of Brunch to visit Peurley Stream. In Elllféf R1V@l' Winding il-l 81111 0111? 011 was largely attended. At 7.30 ameet- Plume' cres of very llenvy hay yesterday 11°" ‘W _ andrew oelluui oyster noi sriage, ihc uveulnc un over-liuwlug pulrlc its ncncclnl course among the hills. ing wee hula in the interee/lu ol the _-` Zlternoon. Mr. Muouunlu le the pun- 1§;j'j,°“,§‘§t,e1s°°o‘},“»,‘,§’;' §"‘,;,}’¥‘,1;,'§“°§‘r-.e“";’_; U0 M1158 501111111 Alhinnnlt. vl Esmond rV¢;I;lvDcr;1V;lce mieetlng was held- in the the green meadows,the shady nooklz, Laymen's Missionary Movement at -~-In Mpntnzulli t ycstiéldliy d@11l?l`9_ geanor of one of the finest furlns 0n‘V,.echmmemyed H, th, -_-_1.1¢ih¢¢;nh_¢|,,,,,,»- W d d tl et 11 SD110 ous hal! which had re- the C001 frngrnnt brcclcs fl`0'm Of which addresses were delivered by A. were Pal’ “E 9* -V ‘-L" H B 11119- Of P_E.I_, and is B, rema' knbly yolltli- boom bu.; 1 real gm; gg'-why|~»p,.hh_h_ _ .. _alone thlalt cured _ml-‘; -.~ (Mus) Eliza pevosque. Mrs. Levesque's advice. Take address 01 Welcvmc. G W laden with those things which would-t€9~ C1111'-011 3011001 19 110lll`i91l1`l1£ Bt. Jose§ll'a Hospital, Glwce Buy, ghthwg Recitation, John Howard. null young alike joined together for n Chflstle Bigger, Bradnilbane, ban- arrival 01 11"X¢ _‘P11111 ‘F0111 the Wvlit- noodle” to ony nomes hlghly»,;ecom- merslde and opened- three barrels J. F. Profits, G. S, cliorun good afternoon-B f,,,,_ Ghmeh, hong secured the position of assistant lsllrned) Slrl\_'lu_1\ Suck- It all>l>ea»rs m,,,,,|ed_ is h native 0; p_ .E_ 1,.lnr,l, contuiuing bottles of liquor, two of National Anthem. sailing and athletic sport; were gh., 00801lHl'- Miss Gracie Woodside ar-K' '-1151' li115'_`__Y"“-144 “mi 1""“d*‘°'“° “"*’but han resided, for the past 13 yenrs whlcll were beer. The third contained dhlged in and hem, enjoyed Ah the rlved home after spending h row. msn. the only :laughter of '1‘h0mu»s_h, B0s¢0h_ where she hue been ne. whiskey. They carried away iuosil of TUESDAY' h dh f V ni y ,Ama 'th days with her cousin Misa Edith M1¢¢1l01l. 1V101'¢1l. 111111 married 10 tively engaged in ber profeoslon of the whiskey but left all the_heer_ am r c ivcd 1 t i htf s'ai£k D ft: e Iliff welt; gs, 8 Profibt, Burlington. E. S. audi Mrs ‘l1ll'K_. W110B6 1101118 is On Lennox Is Vhhrsihg The Hospital gh to he con. e e as p _ ug mm 1°" c em a er g ng re' mu ng MacP.hnll and family Ottawa, are 181111- 80* limi Ui 111° 0” the Islam] grotulated on havinigl inode so goods -A camping pnr.t'y. composed of n, N. B., stated that the race chcers‘to the owner of the farm for . _ , __ __ t .d - _ visiting P. E. Island friends.-Rev. 11111 11212111011 l-0 I‘ct1il'n Wllfli 1101 l11¢'l10l‘ .1 U __3 dl R r1_ Contractor McDonald, Judge~McL. .i es M ay had been wo" by ms klndneifs' wemed their WHY 1"-‘me _y_ B_ Gough and his hy-Ohhh, B,-gd. to Morell. Mitchell was returninglm ec an y negcor _ ond _t-he Shu/rpe families are camplgg ann h _ _ _ . “"5 the "“"‘° ‘ w““" °”“""*"‘* "mi "l“’l' 1"” “l’°“"* l a s lu ith h l rum the election wif-11 11 lvt ninth l rl N .201 s_o.'l'. ni Mecullunrs Point. l ac the noun. n. 0 V _ Thomas ap enred with th da of Dleasure nd cnlo mont. A- or of mmnus 9 W Vt MIT “"1 'A Refuge D1". on' 0 ’ _ p E y a y 11199 RCU-`>l¥lPBll1°€1 by Miss Wnttoi ers W1'i° Were “nauimwa in saymg Fredericton, is in n. ilourlslling con end of the Summcraida brenkwater. l c ~ - flffvlells llnee'Mi1g::cpu1l\rll1§hrfc1i tv-1:25 olulli?-esellhllwaelrd tl1.all"“'°. '“°"°d t° the" S""‘"‘°" '°”9“ im sl1"’““ sa” “"“‘ ’““' “ ¥°°‘1 11111011- The nwntiugn are lnrznll' nf- '1"ney're having u 'moon enjoyable his Province but has been on Anderson of webstervme vnr t' ill Llinlton.-Lorne F. Lea. Victoria, msn. ltended and visitors are nlways wel- time. _Wednesday V1l'l§11t 'theyg enter- Island since his return from Mrs Andersou was formerlvf Miésmxn: nas returned home after speudfiug 1- V _""' come. This Division still llolds the tained n numb(-gr of visitors from coma lash week HMM N _ 1 B -h , Dltnhnnt week nt Clinton.-#Miss lPearl T11€1`¢ Wnn 11 80011 B'-1101111111169 VFD* banner of the Province, and has done Sumnlerside to s clam bake. Bon- ' ac evm' 0"” ° 0'” “ws mm” W°°‘isi‘1° is V151'-ing f1’l¢nn,ndl,after a suited in el resolution being passed, the _t fafvoring the introduction into our B“""1l ppfrtmlients; The Home, Temperance the Army, and Teachers training under '$110108 the sn rlntendence 'of' Revs. J. M which av ov r 3 eunds l that sufficient evidence had l.. turn ok and we tbrofu lr the of Nhva Scotia who is hhchd_ ea 0° '~fi'|_n8 °V° 9 ing contrasts in milk yield' as re- Yesterday was a busy day at the young' lady of 16, celebrated in Put W¢l1_W1l§8_u=_of allnctivelv. The officers of the, stepheuen;>§fu;r?u;r;§:i;l;r:5tu,Tg-izddagt ‘pink pi", is Nudd |° Bui|d_lll§Vy; File; agvay where. the milk is facie case. Judgment was given in i °'n1°n= PM M1- Mn‘=1h°v1» Vice P~v:lJ“1Y 13,? ii* 111° “gf °1,°°,§°“§v 015# Uv 111° Blood and Give New gf in `§§w..’nn‘I.t e°$T}t°§te§3§ fill: 311°. §§f.'ll.§’e'eu1)'$i"§l li1f.§'."§i1én~e lg; ' e was a ns ive o ew oun - » _ » . » ' ' lnwlne gentlemen were elected ou iheflnnd. but sbcni' a lnrse pvrtivn 01 sirenglh' igiilsllnllilgrilll lxirwncellll fliemlléraalliatgg 111;; lilly; 'h}o;1t11'm1l‘lr:'c1l§;`li'lniiGe?>'riE1.; 1 lb' lil t Mill 1, . . ., . _ .1 _ .. ox ubiv Isaac Esser Wm Pierce ls e gevmttggeeaigrseo Iiiwalx ____ ,only 2.9 2.3, while the average yisldV_McDone._ld drugglst,_f_Vvvss_¢alled as a, , Di'st’l'ict work of the following de- mg 8 l om District were reflected vlz,Chas. Bry- ‘his h- Jonatlhsn West, Sec'y Tres. The fol- y€fll`S- ' .P¢ 3' Yr - and Mr. Foster. The evening ses- 1S1“md~ tion was well attended. Revs. John that speakers. Subjects,"The Cholstun's\il1§ l‘-0 . ' M music was furnished by the Choir. Island so 0' n ‘-'- - Ont. contains 17 cows eachl one of lisrrijissedl, the Magistrate considere-I ".\».-fn: 11'; "1 - ' *-1-* ~,.' '_~ '. -Yliihcr 1 mouse think ul the works ol ti lm _ __ _ -sizu.ytu_et_1tav.cs-l>i`whl°l1 mighty mug dhhq; measure twelve fee _ln_.cirpunVlle__r_en1=e The marbles of Tadmor are ltrew- “1“1lth°»1°“Kth °i .tim “Wm .h`9m"1° eu on the ground ' 2l`°'!!;'1'1 up fn thu." lnnvis ia oiehisvn and rnyrlnlla of ruins lu' Egypt ere 1n<1hvn» The hell- 1n'hlty~ldu1; _. nlwt f0,md_ _ long and.is n- sight worth seeing, _-Al- y 5 At no time in ha- me dwg B gm was only 22 pounds of butter fat, or second offence but owing to some .1 'Their ‘object forgotten, their build- 111011511 `“.°i~fn mi1`1‘15°'»'l!’“l‘<1.i’1lil!'» 11|' ~ . 91"” °'”d'w°'°t t° NW' Hamp' gym, ‘ 1. e thirteen pounds left er cow d'urin error 1' ’the k 'V ' 1 ` " ‘ Hl1»W1¢y “mi J- B- G““°“5' “'°'° theishlre' waffs ggwlflad r°;;‘11_§‘;_;"':)11y';9:fg bloog in Eyzgatgle ,L-°;‘,i,g(Zi,1;:-11f1':,h the monlth than the _o1l;)her. herd. = .g ,lvioilal’_`e1:irViv,lctl1:>‘:i_-yggsogliiliglciizg glitz A|_mour,, and ,the S S BS an wh ago he was unitéd in marriage Wim alone can give her, than when she lol' In another herd the welgbf .» oh u_ht,VoV”en“_l~mV1%nn`¢_uho md cons _V ortunlt for service " S eclal Miss ary Lapham of Prince Edward d°"°l°p1”g i°i'° w°“‘°'”l‘°°‘1'. It 1° mm( from om ww is sw” “sl 14-4 Th’ "AJ °l` A' ` i Rum” 1" third' D 7 ‘ P V h h _ then tha-t any inherited tendency to Pl.J11'nl ' ""“ ‘ e t s url ight B1 ' " :pit 1 na lla s...-a .,oap 0, n,- .ar w o survives im with four an ‘A or congum The re ns fr rl °i the hh thh 1*' 'tg _V '* ‘“ gg . _ V ,emi nylon heed, chi, the next evening, but 15 pounds the norning at 11 oeloek for eltrent wit factoriesand creameriea in this Pr - . -“ >-°~ 1'9"'-Vi' -19* -5 »~ - " -91"* The Field nec v wished nu expression "ns ghd ""°° ‘1““€1‘f°"- 'I"“`°° °.‘ the slightest encouragement ro rrp-'next mnrnins.. .1n_sn_y other _cows nseses. _ » _ evlnee show inet the nnlry lnuustril ` chf understands `bo perfacti nf _thn er and successful cliltivait,'loli.'of _ - . .~ '~'.*~*'»`."‘~.'.>"-".-."`»'.y»~'.` or opinion :from the District ue to the u nu und two daughters resided _ _ ¢ 1 _ _ ...The ‘Gear 'lpl £11 ‘ °"‘_' li. wbotbgy- the Distr-ici; favomd the with t-heir parents. One son 1:11233 hgugf gi°;;;g°:,hiE fsP?;1h|:igwqllllllklyayngtlgclgifvihrtiigeslaqillltgl ' ' ‘ gaffigggiasfsnéhlst 11:3. by °b°'ut,1f;i|'° Association li:ll1l,'l1l1s"c$ ,1.ili lmlalmimatlon of the N. B. and P. married and resides in Dorman, Me__lmn"ned1ong hours indoors’ in atoms' man .is keeping A duly “word 0' V I--~_?i._V _ increase is not gun an yx)1;l;tner 2; the. Methodist, V hVVnm;_ iowlau-Mo“_VV E. I.- S. S. work or preferred going- 111111' 11 l on. back to the former arrangement when BOSC P..E. I. had a sec'y of its own. The ' Convention was unnn'mous in favor_ One of present plan. Resolutions appre- tents lnlgiréied daughter resides ln hmm, ahh ‘Wim-ieh._.gi|-is doprogneq- milk, the cause of such sudden drops . -_ _ _ . the increased number of patrons but °3“°»z`J“lY 22“f1-_' 71.1119 i1"9i"<'9‘?l°“ ' by worry and cares. All these con- Will 119 =10llE_l-if 101'. and measures .- ' " - to the increased- supply from the W” °1’°"°d at z"l0»1’7 'i9".l7l’i°3'%1-n“` f the '* V uicionu quickly lmpoverish the blood tnlwn. in lwnfnblc. to prevent the c H patrons. one of the been denying ‘”°11'°.° 1°‘l-“Y 3'1"- -F-115.-;»lil.1?1‘__. #-1 ° m°“t "9i’°°t°d 1“h“l’1' and are among the most common 911111111856 “|111 1106!’-911011 COW UP to _ ' sections in the Province ls‘Emol-aid, This W4” '1°11°w-°‘i'» 1?Y ¢\"w°% " °i- of Bunbury, Lot forty eight cause, of Holmes, among grow ng her maxium capacity ' 1 . S On Monday morning 5 500 lhs 0| mm( year- lt l th _Pr ‘ .1 . _ _ _ _ s wor _ ry o e . _ ciative of the visit and labors of has passed from time into eternity' me hd uh W h 1; 1, 1 Twice a dlsy rain or shine the Bllmlll HGIJIGIIC lllglllh th N 1, ' M¢P110Q- 111111 t1l¢5¢¢i'y~ the tield sec’y were passed unanimous-, in the person of Eliza Turner beloved gym ua gli; |E,dh°n;_1Ea§ her zhrengg cow hh, to he milky, why not ;mke- . 'V ‘dam _.nd 33;, ‘fhouf nf; n';fl‘;sRl‘£': Whig; tif: Trehg Rem,-gh ,mm .gl ' V` ‘ .Loi ly also vote of thanks to the hosts wife of Robert Bovyer, whose spirit in fa-fling and gh, 1,., bwoming p,,;1e'eacb milking time bring in eight of _ " _ - mmé day th' muawmg patrons "nt lug sB'§1:d. -seven -sc`h6ola`V'.i‘e,-s' nded. ‘ ` S Di - - ' 111.1111 nc on noininstion wah,-ellie .0f U10 ‘lily l0l` 111611' 1‘1l1‘i 1‘05l>1'11l1iiy Dcncnllilly 111185811 away 011 -7illy'snd nervous, has no ambition and is nine cents profit? How mls/ny man , mmnh _ |0l“¢|‘l ‘h the mnhwihg hm,mmth_ From Co rs,'-amid Miss Elvl/8tJcw`art.` ' A The Convention clnaed with benedlc- fifteenth. For many yea/rs her ianguid it is a certain algn th'at'mllF eight tlnies before tbey.~g¢¢ ohh ` ‘ '__ =- ' '_ C Ehlmohld. Mrs JL Hh‘h"_765 lbw w_ gnted as follows: S, `B.`A`itken','¥4lU/llc _ ea tion by' Rev- W"l~ 1”l“W1“Y- , Sight was no impaired that she was her bldod is failing to meet the de-'cent Droflt- from some cows? _.DLI l'll\f|‘0l’|f Pllll ' lfftd- }{,.](¢yn¢. 553- Gm Mh h 506 unable to read; yet hell mind was mnnrla upon it, because it ls impure _ *‘*"° A' ` - .- ‘_ A‘ _"{ 1 ` .~ _` . l 5291; T.~'Maell$'1ntee, 611: verr'1nte'°sti"g p&i’°,‘°"'W“5 ` ` ` ` ‘ _Fre'm.Nolloboro’r J. W. Stewart, 536; rem by RW' 1'? A"‘M°Ph"° wil..-'-We Stewart. 535° Geo .Bowness E01' Pr°1’1""“" which 121'” ' ' ' ' ' 5 y a abou vi 1|* is not only powerful, but so- tru, ||;| power of Ncrviiine. Remem mn thpt Nerviline will not cure immed- hm, of la ly.” Neryiline is an anchor _ S I Th "°;‘E§,'|',:",,§’,;‘Q§,’],,’;"gf,',1_"f,‘f,',,,, bg one, lleulionnligd we?:lni:r‘rrea lunge ll¢tl:,°h1'i'i° vifillifgig .liliinlil :re role §§1,,_22f'§,'°fh,, ` ` c ry at C ifton to await the 5' h||»mg`¢|¢g ¢ 53| 1" l hp f _ _ glorélolns 6-53,1:-ec‘:.ii:;i liner; wt-'ben 21;' sgnt by mail 1|/t 52,0 c:\'l:aT_lr';x or ‘six Vmh fxfd “IT i'° » s se rs s ' f 1 _ _. v . - hnfecd for rheli- thu :ho an 'any' dm" In caught amine %'o.L‘gr°uk3;l;I°.,D6n'y“lmfn' lhlmdr service 1l1*11'1“'. l1°""“1'1 up to meet the Lord in the air and » -»_'.....l._____ ” it "U" 1°' A” l1l»h1'¢1l:“1‘°‘;:1so be forever with the Lord. Mrs At the`Clty Police Court yesterday :Egg eh" . :V1:V_V11:m§_‘;°_c,_;_.l;ovyer leniven homies ._ nhhml eng simon monomial ellnrrou with h»in¢V V.H¢,,,_. in t s follow ng oh ren. r an isorderly was fined $6 or 80 dn" ton ‘hd ‘"d1’“ '° Beatrice at home,Mllston hand glvlalett and James Doyle for being drllv-kim fum. or five ln Bunbury, Mrs en esnnf. and d-lsordin-ly U5 or'80 dalyn. The ' bm" Brsekley Point, Mrs Blugsldemon and cues against Sylvester McDonald fnr'2|’jbnrn¢,| instead of Nsrviline, which is ug. .'.,;‘ r _ h _ - l _ - nm nf P