_ ,__,__ ., a-IARLOTTETOWN GU ram 3 . ' - . g . s . q . ' ‘ Q ‘ - - a , 5,. | , v; [muggy [V913 ' H“ ‘t0 Keep Have Birds And wld°r Dlstrlbutmn Can Will Be Re res" en: ' i i S Canadian Cheese , _ ’ - Of Registered Seed ' _ p _ _ ' ‘ ___- __.__ i~ m’ .. " "W madame...“ ......... Animals Brazns. o: s émclvvnmtr s... At Lwe Stock Exposztwm .- _ _ various sises and can be saeured _ ‘ ' - ._ ¢ ' _ .» aeallsessonscftheyearsadin —u-— kahlfldfliehlllf; ' —___c ‘i: 001i‘! IIOI generally llihfilt qlllh .&ny pcopi ' VIIUUI “N”! ' A GILDA-I! became zferifaatlynsy cn-lgwwhathiiedsfi B! JACKMINIB CANADIAN’ NATUBAIJIT 0hr lllllflQlfiidbegtig more events, with a days a time a H5040" , 01¢"!- - c" - ~ W - r- aw- M- ~=»=-’°"°““-°‘-,,°‘;f,- cm “t- s” " my l» s: mucus-en's m u‘. cube: 2:." .2122, r.» s.“ M "' “e "d d v "M, fiitmr-mhw» e-mj“"%="»‘f“ i-mem him-r from w_ hoidwordintlwseda. , -"°I°Wh° "Wmdifl- ' .. ' * “uz.';*z'r.'ts.*.ar.rl“h-s*.“....=""u"rl “b” - 5- :*:.:.:".::"":.:.:"":.:.1:."":.':: m“ Mme-chili?» ‘filth m““'”‘»='"”"~ 1th‘?! wit. “ll .2. '?‘..'§‘. ‘scan: s. m m» ~1§é~“‘§r3er~“i’»“ ‘f-‘ii ‘h. e»- wfi i" background. it is - - . devoted m such use December 1st largest eompemi yea.- u s. m, 1m, _ keepitingcoaeeumenrcreensid-eeerthefevieoftlwairmgevervQIWBIeYeMkeendBi-ifinlnhduuekeueusb olihcbest seed w ' v m“, my, 5mm,’ u, 3,, "WWW; m, Iflmflmmediifi mm, m, thing that ereepenr upon u. Thus as m- west es British Oolumbh. as methods, with the result mThm“_°”°’Th;“§§ p3,}; Sig‘: goéh°fgécml 'mn,, m, Guardian. They cover such a see that, in spite of adverse 0on- Por the svmse family a 1o- Be m“ "H" brain e11l"°m¢-b"° i" W‘ i“ WWW. "W Jew that the seed which they sow u m dune,“ m,“ m, ‘ma, mp, b0 m‘ ‘m, m “he, mm“; poum we”; g ‘many . maven]. that does M say _he didn't give the and Atlantic coast, and as fall m “p930;- w me w“ 7‘ s, ‘ flay“ of and arasoflevzil tllyitlllll in the Hath Provinces, the ‘m mount m bu’ M on” “m. on“ MM or "ma, kingdom hm,“ and mum u not,” Amman‘ by m n ma u‘ the Chictzgmock Yards lsatuldaig . The railroads I ma“ ' “u!” "N158 ' u, ’ m“! 5*‘ tghmufl Entries are egresst are m 1"" m“ "m... wry.» we» M» - nmsrtbzsuzuwm m... "rub-at s’..'"'*:1:§... W“... hi? u... .. u... s": Mswsww m $11."; y, one my, ulnogmyrehyegrbemggywri iycrstsidawithsthinlayercflafer- snseroplsneordroppcsdcwninaqumlyflq-humqmf "9 7°” ersaroreceivimalcwps-iee Plflflhlwlillldkfifipihflitinsl mtheaninselworld-takeadogtheselocalitieacoulmwithmli 11.4. Ontheotherhenditistnsethat . mo“ gum; mum,‘ cool a place as. possible until re- for instance-if a cruel-l-icaried of compose or other instruments,‘ m“; “my - ' FE°mudfiuo$a m“ m‘ ‘IE END. AT I083 quimd. ‘Ihe other half will keep man comes on your premises and and 01111 depending on their own my our-aw qhggroogngtw gin‘;- M_eal Al A l“ Bducerhssteselihispiodrsceat mlutmmbmttu flelthandmoistifput on aflst kieksyourdoginflreribsycucsn breimevenfindtheirwayiosuch 1mm-g4mqwmgy m mywgw ____. Protenilsupplement. mmeestnfseertsimysu. .~ minerlvie fltliwfltflfwfled-nl-perwithrestassmedflietthedogwillform snusuerotandittbeyeidbevq-mugqurmmgonywm, (q_nw,,gmu) . Cow sgingbutpossiblythilismayup "mmmbem“n”dm't'"sx7°“tdd°_d°mwhmi-hononbwoutofthatpelefllflimflwwldiiilkhllbm efnidtbeyecuesksewwbetserit s Whattheoutcosneofthepreeent ForDairY 5 c» mgflvgg", ,; _ s...“ rumours? it; sum".- smut: marks r’;..:".-...£‘..:?;"*:=..P";:t “s”: as: smear s" .2: W..." .*““""°"....‘ "H *" “WWW” wvu-"ct; (mess-rm... ..... m had been performed on an empty or knife. leaving the outer edge_ un- quash kindly to the animal and bring them out of such desolate {mug} enough uwqrgrnthe ‘virigt; none cf us gbletoesay, but There an three factors that ecm- W stomach, so it will readily be seen cutfirheoheese should bet up- mo," bflngghhn a, bone, the dos’! vlviiilfliiiliil- ’ names of their mops but have been from all reports available we here blne to make fish meal dcservfnC 0!. that each one is "as hungry es s, side down on» the plats as soon as ‘mum, Wm be mo“, kmdjy 1».- h “m! mnnderaflm m om- uv, m”; (we. " o» t“.‘.‘.‘:'éi;..$".'...°':‘§..'r."‘m°"....‘. 2:: azt.".s.zr;r.z ‘fPi-‘Iiiifi M- M ===~-= m“ - o‘ ..S.“"'...";=.:*¥:.;:;-r,,M-- ii“.’..“.‘i.'zu“‘eii".“i-i°fitt hi??? $5- M hi“ my" " ' ..°:...."*°"“ y ' hes knowiedst. or brains. if W“ °" °n be ' 1 1.11s would m. in product; it carries a very pro- ‘gw: plézblfllauflf. the. minter could ‘w; the chegscmfrommbfiscobgainz Wm, w “u 1t m,’ 1,0 know a your wgerandsh. We have demon- m? “my wtkfimmilfugu”: 2% wy“°tl‘::: wumm A‘: omwem Conan. of ‘mm, 0mm: i; m‘ "°""h°"°’“"‘ w“ m “° iflehdflvmI-hmemy 'm°°""‘"“‘gbu‘”h“b°' larlooa-lityorwhichperhopsiscrfcountryhasnotbcenovcr devcl- con“ ehishpeieeniaseefmhl- ‘ ble market cm be cultivated The ' inly thins miliihtihs sseinet the . esi-ern market is the very high ight rates. As a matter of fact mum on the shipment micr- pqicsmountedtomnthanthe sort of the waters. No s. laws: rate mty he avlllwblc if LIN" u; quantities were shipped out. l "we are having weal‘;- ham at present . . e dseoldmlflscunetilhlllihbiii Farmers was ust a matter .f habit. or the .1 t dry. cheese will keep weli if put in a eiesn. dry glass Jar and it is just as valuable forwooking as fresh moist cheese. It will usually have s. more pronounced flavour than fresheheeaeandthisisoften desir- ing; when combining it with other s. puddings, followed by the beg}, qr beef u‘ utton, was the common fare. Kickshaws. and aches 0f the had an Experimental et-Argsntincv-ds making , it of trouble I understand. “Alberta is soinsvery hrselyq imo mixed farminsmssid is BOX“; "The valley Field I 800318 ahead i! steady will’. The hi8. @5195!!!“ W11‘ mu the nitration. (but flier Ii!- that may not‘ be such a bad 13111118. because they are able to make ex- periments and‘ drill wells“ Jb-ibfil: ll cmipllllflli will‘! 11° romfinanoe. Conditions h the Val- hy (us we call it) look b01351"! indeed. The Oil M18156“ 1399-55 much to Alberta. "r m a eosl operator the ether day, he 010N594 m‘! h°i>° nut the weather would come to semiwuchsswewouldliketosce his business improve. we how he may be dislpiwmhdi "With my kind rewarde- lslthiully. R. H. Jenkins." A very elite letter. with | valuable hint as to s market for vysters. In a short postscrivi M1’- Jenkins infers that we are unimovm to each otlcr, but this is only PB?" tially true. A 300d m“? Y3" 18°- when I was a "hired mm!’ m! "Y" mar used to visit “Jenkins? at once a week for supplies and Freezing Injury To Potato ..__.._. (Ilxperhnssatal Farm Note) investigations conducted It W! Dominion Laboratory- of Pie-Iii Pathology, Charlottetown, P. l. L. show that, lbtllfllly. three distinct types of injln-y to potatoes mny re- suit from exposure to low temper- atures. as follows: I. “Host NW“- is", occurring in tubers havihl been exposed to low temWfli-iml if called a “singing perfeetim n, m“, m Farm Notes over the 0pm it was a very IIHIATI FIIITILIZEBS y of currents ' FOB TIMOTHY HAY us ea of sowing 1i pounds when tired ecdnitmee deeds, or100 peas ofsmmonis, or a low tub, (a half-barrel) with warm water. The man downonasrnsll stooLwithcne in this order. First. he washes his hands, arms and chest; head. neck and fecc follow, and he the lower extremities, one other. At such times the North of England, coaifields as wclLHoWevcr s. more complete ablation took place at the week-end. If the miner was to be called at 3 a.m., he immediately went to bed. when his wife would dutifully hand him his pipe already filled: and in a little while he would be in the cnioyment of that sound sleep, which es e-n old writer says, “falls to the lot of those who labor hard and think little." The back-shift men, who worked during the day, after dining and bathing. ‘ ‘“ ‘ and spent the evening as their fancy dictated. As ems-tier cffsirnese toall, the mine-owners decreed that a mm who worked at nidht one We! yield of .66 tens pee" acre. rssrnns fiurnovsuurrr. by controlled graz- , “ which ‘ ‘ ing a good deal of attention art the time sboindwcrsduringuiedayfcrtbsohowlyof was in- foliowing week, and so on. creased 46% by the following The nriners’ recs-cations. both in- asnount of f : doors and out, will form the subject of another note maximums or r. s. rsmm The rclnaining members of the Rodentia of our territory are the squirrels and the Veryius F811 m‘ “Rabbi " es it is locally termed. slightly more than silfficlent to pay for the cost of the fertiliser. experiment is to be continued. sufficiently long t0 cause the for- mation of ice crystals. when c“! open, such tubers exhibit, necrotic areas of three different WM!- namely: ing necrosis. N008- niaed as a definite darkened rill! at the stem-endof the WWW “d due to short exposures at low fem- lieratures (b) Net necrosis. also in- dicating an early siege of frost in- lluv and recognised as a net-like potato tissue. (c) Blctching, which appears as M18“- lar patchu varying in colour from a light gray metallic tint to dark brown or black. This WIN 0f 11111117 results from excessive exposure i0 10W temperatures and in MW!!!“ cases the potatoes are useless for Wed purposes. 2. "Freesing Boiid". This occurs when tubers are 0X- liosed to temperatures below the freezing point of potato tissue. When thawed out they are rapidly reduced to s. soft, wet condition foi- ivwed by decay. s. "mmihs sweet". Potatoes turn sweet if stored for a number of weeks at lelhneratures near or slightly above "0 derreis rshr, a fcatum due to the accumulation of sugar produced b? the slow conversion of starch. Potatobs iniufed by frost are not t: inn retardml sprout deveicmneni Ind the possibiliw of iffeeted sets rotting in’ the ground. bosses through Milli!!!" of low temp" ltures may be satisfnctm-ilv elimin- "Mbvthsid ibuoffourvcrv beneficial rnessr r as" follows: (i) a a?» the‘ . . (n) Itcrb . ‘mills a temiwdreture wween. as . ‘° 40 d-ereesj. By so deviuqthe : ntsim will nee turn ewe-t and , Wm"- w"! has flew-loo; m‘ Po‘- "w worms-venom»: nu- enid "Wu druids be dams-swim ”""<=“'In amidst frost at all times W" should be carried in a heated 3933M; '.t"tr.'°u“.mh’-é v before heavy “W been‘ Mil-venue m» mud hlhble for seed‘ mirocves because by Iofflllllifbflfllgqn “ "hm u u known mo. potatoes‘. Agricultural And National Income Agriculture is the chief single in- dustry of the Canadian people. Ai- though in recent years its net pro- duction in value has been surpass- cd by that of manufactimes, it is predominantly the principal indus- try of primary production. In addi- tion to providing employment to more than one-third of the "gain- fully occupied" males in Canada. agriculture provides the raw ma- teriai for many Canadian manu- facturing industries and its pro- ducts in raw and manufactured form constitute a. very large per- centage of Canadian exports. The net production of the five- eighths of the Canadian people who were engaged in what is term- ed the creation of "form utilities" was given in 1930 as 88.216.746.785 to which the primary industries (agriculture, forestry, fisheries, flapping. mining. and electric pow- er) contributed liszslsnasoe, and the secondary industries (construc- tion, custom and repaid. and manu- The Red Squirrel (Sciurus hud- sonious) is an entertaining little animal. with none of the shyness charscte ristic of our woodland creatures. It chatters. scolds and sputiers at s, human intruder, work- ing itself into a great rage; and this habit, together with its small sire (as compared with other squir- rels) easily leads to its identifica- tion. The worst trait of this squir- rel, and one that quite ovezbalances its attractive qualities. is its proved habit of devouring the eggs and young of our smaller birds. One close observer believed that each squirrel destroyed in this manner- ovet 300 birds a season. Ibr th: kept down. ' min tells us, in his Natural His- tory, that the Chipmunk or Ground squirrel (‘rsrnias striatus) istnhefoilndintheProvinoc. 1 have not seen any of these inter- esting creatures. but the Island-is quite within their ranso. I have however seen the flyind squirrel (Glaucomye sabrinus ma- crotis) on several occasions, tbcush. in general, its habits are nocturnal Flying squirrels are distinliiished from other members of the flmilyi extensions of skin along the m" sides, uniting the front and hind legs. so that when tho animal leaps with its legscutelvi/i. the ex- panded membrane buoys it u While cutting lumber in the mwlnier-Ionceaawoneoftheae tree. and launch- ture were field crops. fruits and | vegetables. Inapla products. tobacco, lgrass and clover seed, honey. flax i B‘ g- i g5 5E s? i ing itself, yards from leg? ‘i 1E3 i? 2* be. handled 1mm it in. certain l! the innnsraturs is above the “We: mu. ¢ measured or proportioned to your teem of horses, which most common animals, you them which stall I which side of the tonlllfl and other common tiring! them to do. Does this show that they have brains, of knowledge, or intelligence wish to term it time‘? One eedegotoacircussndwatdh perform and d0 thing! are unbelievable; and while ot agree with some cruel of trsning animals for a yet it proves that they have which enable them to lee-rh- om- ind sanctuary. if!!!" pairs of mallard ducks, on the ponds all sum- but fly all over the coimtry- and raise their young as far i??? pang‘ ‘this? ponds, with the little ducklings pod- diing along behind, and in two or three days after they are hatched what happens? Time and time again I have looked out my din- ingzocurwindowandseensnoid mother with a whole brood of little ones, standing at the gate, waiting for me to come out and open the gate and let them info the pounds The fact is, the mother duck has both wings and could fly over the fence. She had never gone through this gate, but by watching me come through that entrance in the fence six or eight times c. day, she had knowledge, brains or sense. or what- everyouwishtocallitto know that by bringing her little ones, that naturally could not fly in that spot, tho/t they could gain entry in the enclosure Many s time this has occurred and many c. photo taken of the glad mother duokwu-itingatthegatetobesl- lowed in. In the beginning, I se-id that in some ways birds had brains superior to ours. Let me try and explain myself. These ponds on my bird “ yaresosnaliincom- psrison to the North American con- tinent, that no words can express the proportion of them to the mil- ions of square miles of land and water of North America. Even the point c! the finest needle pressed on the map of this continent would represent several square miles: so again, I say these ponds, which comprise only a couple of acres on my bird sanctuary, cannot the he North American continent. It is a welllrnown fact that since 1909 I 1915 have tagged over eight thous- and Canada geese, which repre- sents alpvpro ‘ ‘y forty tons of bonkers that have gone through‘ m hands andhed an aluminum tug placed on their leg-S. ln order to but what else has it proveu? It has pmven that these birds came back to these same mud holes year after your for feed n"d pl tection and kindness, that l try to give them. It further proves that they know s friend frown an enemy; pxovm that they know s. plaice of safety and rest, or in other words, where to go for s. breathing spell. But the big thing it proves is that they have been given brains. knowledge or sense, that without the air of com- passes instruments or such like they can get up during early Oct- fober B-t the Arctic Circle. with their family following in single file and in a short time come circling down on these little artificial ponds of mine, when they know they are safe; and in the early P9111 0i March, the ones that have escaped the deadly aim of sportsmen along; the Minlssippi valley and thej Atlantic seaboard. rise up out of range of shot and shell and keep at m Ground L has given excellent res Write for i urockville Railway Ilanufa loved r lave been tagging ducks, and since‘ study their routes of mirgration-l prices delivered your nearest OPERATING GOVERNMENT LIME PLANT Brookville, St. John Co, N. B. (H. G. S. ADAMS, Manager) l come common, one and all know they are the sauna robins that come back year after year. Although a] whirl’! brains are ems-ll. yet that. llttlebirdsndrlglvtdownto thel little humsning bird, is given brains‘ instinct or sense or knowledge, or wlmtever you wish to call it. to find its way even on the darkest of lmsuaceTbcnertday we m- unovedthemtocperinceroilrbsck docnwheue there wuss nice Now, this family of goslqnever ;went fiverodsfrommrrbackdocr, but were continually gdrglng grem- selves on this clover. and of all the big babies I ever saw, young wild 8905c are the limit. After they were larcer than their stepmother, I I have often seen them huddle around her. putting their heed; undes- her Mugs, each raising her a little higher until she would be completely M’! the ground making herself into a. portable lwune for the heads of these six goslings. Butthessdtiungwastosecthis. 01d Sender. Ind to hear him con- iiilllfl-iili’ Bivillfl those three search- ing. sad banks. We put blocks of wood and pieces of fence rails in the rsest, but this broken-hearted old fellow rolled them away. The sick goose stayed in the pond, near the nest, but he strayed all about the premises, constantly taunting for the six eggs, and for the gosl- ings the/t he evidently knew were in them, returning every few min- uics to his sick sweetheart. He would bow and talk to her, and nip a few blades of grass. then off ‘ again on the same beat, honking, 998i. West. lwrth and south. I never saw anything equal to it. " l his honking was heard by the six goslings, it was, of course. all Ilatin to them, as they knew no other parent but the old hen. Well. the novelty of having these pets near the back door. soon grew a little unsanitary. 1nd we found they won: a week bigger every seven days; and my brother-in- lawk oldest gave me w kindly understand, in as pleasant s. men- ner as the English language can possibly be rubbed in. that our beek doorstep was not a wild goose roost, and that these geese had to be re- moved immediately, if not s little sooner. Bo, I concluded to take her word for it. But, sit that time. I had only the big field away from the house. 5o one bright mcnrin in June, as the sun was Just high enough to be sparkling on the dew- r I miwn BROOKVILLE imestone nits where ever used Siding. cturing Bu. Ltd. ‘dmpsthetwerea/pparenfly lang- ‘ mother oped. and with our immense nat- ural resources it shoulg be able to make progress while countries whose resources have been ewpicit- ed and where every industry has one may say, been ever developed, will have a much more difficult job of making the inferior quality wherever grown ‘Failure to compare carefully the merits of the different varieties and to choose the variety in each pucvailin - adafodsytorapid prcgressis railway situation, we are railrosded to a greater extent than any other country pcr capita. and the great problem for our govern- ment and people is to devise ways and means to lighten this quor- mous burden. As farmers in a province where agriculture is the profession foi- lowed by three fourths of our people we can “sit tigh " On our job by making our business more efficient in many ways. we can avail our- selves of the help supplied by our Department of Agriculture whereby we may be able to raise the stand- ard of our live stock in taking ad- vantage of the present system of using pure bred sires; those of us who are deirying if we can raise _ the stands-m of our milking herd. say one thousand pounds per cow. what s. difierence it would make in ouroutputa-udrcvenucorif we are beef breeds if by raising _ the average weight of our market animals two hundred pounds by better breeding and feeding we will have made good progress; the same applies to our hogs, sheep, horses B 5 '< been so contaminated i??? crop has been ltable for seed and has suf- serious deteriomtim in mar- t value. Differences in varieties to time of ripening, color, size d slime of kernel, and in mili- Eliéé 5B 3"‘, m‘ m“ and poultry. Then by sitting tight Islmbym-emmmd. _ my eschinhisorhernichmwewlll Division. Publications Brandi, De- oif Agriculture. Ottawa pas-tment “mt 1"- 3- come better times. We the people of this 0r any other country are the means of either growth or de- cay, as in the great law of nature there is no standing still. ‘merefoze none of us should be boo willing to blame governments as all such are only what we the people make them. A progressive Population make a progressive country and in tum a progressive government. Then brother readers it is m.“ it? :2: ‘ii 2.‘ h . ' ma e e mos o e en ven m ‘m- glmlzvmt u" us so the/t we each and all may . w“. Y ° “d? hear the “weil done“ as a tribute aim We" hi1 aha-aw Jag: to our faithfulness. Johnson cumming from the north pond, flapping and honking like s l creature tilat had gone completely mad. I turned and ran back, fear- ing he would kill every one, but he beat me there, and thank God he did. Ilbr, instead of killing them, as I feared he might, when he got within about six feet of them he stopped. and with his head and neck straight in the air, his beautiful chest heaved, and I am not exaggerating it in the leasi when I saw that his hank could have been easily heard for s mile sway. What he said I don't know but each gosling lay fiat on the ground, and he put his heed on each, apparently caresing and lov- ing them. In turn each got up and flappcd its baby wings. Just then I cast one eye to the north, and here was the old, sick ‘ g, falling down with weakness every rodrshre came. This was the first time sd seen her m, h; over the bank of the pond since 0f 5,61; ceaclg §§"y‘f'§,.°,‘,.:§°,§,‘§u§,t°,‘;;’; she left the rim. The young were.“ w,“ wded b . y nro y serving milk now over five weeks old. Old Jack a; s beverage and by "Sm it m,” longed and aawtollrsrhandnrand 1gp 1y 1n mums mam mum. muk £88k wsriitbhlimzl: puddings and other nourishing raster But this dear yold father shines‘ children “hmnd be tam“ - o drink milk slowly and to take it N111!’ "i946 99W"! MP6 5M1! BM! at the end of the meal. as they may forth w the wins before she zohncgieet to chew their food thor- i-hm “m” m“: worth if they drink milk along while for me, and I dont want any The majority o1 children mm to render to ask how it Wee tho-i’- drink milk, but occasionally there this old pflir of beauties knew their is g, @1114 who g5 no; fond of mm!‘ did know in which case the mother is con- __ swQd- fmfllcd with a real problem. Pa- st i-e tiently and tactfully nu must most beautiful tins of the day. 'I‘he‘create a "milk appetite" in whole earth seemed to be trans- ‘child, by preparing it in appealing ‘ 1 Y! ts have been ob- pun love, with both ends pouringflained, particularly with younger ourupon this one spot; for. yoinchildren, byjsing gimp], mghods see, this dear gold bmken-heartedisuch as these: allow them to drink father and their sick mother united I the milk through a straw; change and knowing their six loved oneqthc Blvheerancs and flavqm- o; the which they had never neeIbefore; Ofumilk by seem; a smell amount of word-e. an: mhocola . caramel or maple syrup, Minion of i-hievfruit Juice or honey; tell them in- Mllltd my bflih W, lng stories which incidentally "hi" I" brim out the value of milk: allow . Ithem ct serve “ masher-a child adult men who iilces to be independent and enjoys their parents. daugh- using his awn pitcher and pouring , wonder if we slmli_ the milk info his glass; paste s. them in heaven, but when Ilcoicured picture on the bottom of this reunion, that ques-' the glass-the child is attracted by was settle’? ufgwver in‘ myncgzur and wiléhedringricthe milkflig because _n eaven r see ure w c Vg goose the knowledge shmild be charted frequently: which I have just outlined. how children are bero-worshippers-teii knowledge and brains them about the athletes and other ing on every blade started from i‘ 1 house as usual to in under the boiler mt the factory. called the goose family and all followed me through the gate, maly quieter than domestic fowls. As I passed through the barnyard, I kept on dropping r. lit-. tlefeeckandtherylni-rptflthitafter me until they came to nice, clean, dewy gram. There I left than and Importance of Milk Children's meals should be built around milk for it is s. food which makes valuable contribution to the normal growth and health of their rhoidiy growing bodies. Milk not only supplies proteins of highest quality for muscle building. fat and sugar for heat and energy. vita- minea for protection, but is the most abundant source or calcium and one of the best sources of phosphorus. the twc minerals which form the foundation of the bones and teeth. It ls, therefore, of para- mount importance that every child should ‘have sufficient milk to in- sure the development of a firm set of teeth and of a well constructed body framework. Eminent authorities are agreed t in Cen- it! The greatest detrimen our M“ h" m“ 0V9!" 0f hEH-IIUWH @115, make progress and will be units in making a better and happier home and country, and with these will erals, chiefly phosphorus and cal- cium, both lacking in our horne- grown feeds. With these points in mind, ek- periments were conducted ‘ “' the lest two years at the Dominion m ' ta! llsrm. NEW“. N- 5- to determine the value of high quai- nshmealasssouree of pro- ch cows. A basal ration (oats and barley). WI! bnlmoed with fish mealincneceseandoiimealin the other, 125 pounds oil meal or 50‘ pounds fish meal being used for each 800 pounds of grain. ~ The results of these experiments may be summarised as follows : Slightly higher milk production was secured from oil meal as com- pared with fish mes-i, but the dif- ference wu-s rim significant. The a , ‘uctlcn secured was 22.56 poimds per cow per day from fish mesl and 28 pounds from cil meal. On the basis of the consumption o! dry matter per unit of produc- tion, the two feeds were practically, equal. ' i " The feed cost to produce 100 ipounds of milk was I cent higher . on the fish meal ration than on oil,“ ,_ mcsi, an insignificant amour-rt. g During the second expel-intent. records were kept of the body weights of the cows on test. when A receiving the fish meal ration. the average gain per cow was S pounds, while the oil rueelrsi-ion gave a. gain of 6.! pounds. ,_ The fish meal used was of high quality, (below 3 per cent in oil “ content). and no difficulty was vex;_-‘_ _V perienced in feeding, either as b0 palatability or from milk flavour. ratin, costing $31 ton, suits would indicate that with oil meal costingbwperton, fish meal would be worth $50.56. or with oil.’ meal at $45, fish meal would be worth $60.80. ' While the dais. given are based on only two experiments the results are so nearly identical that they indicate: Fish meal is a valuable and economical source of protein and minerals for the feeding of dairy cows; fish meal ma,v_be re- | commended without fear of any in- jurious results. providing it is of good quality, that i.s high in pro- tein and minerals and low in oil. ‘ i; ‘b . . .1- __~.;_=.;_* Colleagues Honor J. B. Spencer On the occasion of the recent re- tirement as Director of the Publica- tions Branch, Dominion Department of Agriculture, J. B. Spencer was g presented with a suitably inscribed Sheffield tray and hors dbeuvre dish, and at the same Mme Mrs. Spencer was given a Sheffield Rose bowl filled with roses. The pres- entation wns made on behalf of the entire stafi’ of the Dominion De- partment of Agriculture at Ottawa’ b_v Dr, G, ‘H. Barton. Deontv Min-r.- .' ister, who paid tribute to Spencer's ' lonir and distinguished service and to the prominent part he had play... I ed in advancing and broadening the - publicity side of the department's activities during the years he was, director of publicity. ‘The gifts were bended to ‘Mr. and Mrs. Snencr-r bv Miss Marfha Web.- ber who for some years had occu- nied the position of secretary to Mr. Spencer. In replying. Mr. Spencer thanked the members of the staff for the splendid co-oper- ation they had given him through- out the years hnd also exnressed the warm apnreciation of his wife for the gift she had received. u l INTER MUST snu. n . BY NET which‘! Recently inspectors of the Dairy and Cold Storage Branch of the Do- minion Department of Agriculture have been making a closes check up of the weights cf prints of butter in order to insure that the consumer is receiving full weight. This ha! disclosed that the legal r quire- < mcnts concerninc the sale of butter are not being strictly observed b! some vendors. These regulations provide in Sub- section 3 (s) of Section 6 of Part I of The Dairv Industry Act that m1. . butter intended for sale that hal been moulded 0r cut into DrinfA blocks. squares or pats must berry, “of the full net weight of one- quarter- pound, one-haif-porznd. ens bound or two pmnds. but nothing in this paragraph shall be held to apply to butter in rolls or lumbs, of indiscriminate weight. as sold by farmers." The inspectors will continue the check up thmuvhout Canada in cr- der to see that eoiisumers receive full net weiebt. i 1 houderccgrowsrroag. vssliaaefsfarcatsaallasea