N OVlBMBER 30. 193i 
     
    
   
   
    
     YES TERDA Y’S S TO CK A 
     
    
   
   
    
     1-— 
     
    
   
   
    
       Tllelzicgtrzal 
     
      Stociange 
     
    
   
   
    
     (Spccllf to Johnston A Ward) 
     
    
   
   
    
       
     
    
   
   
    
        
     
    
   
   
    
       
     
         
     
          
     
    
   
   
    
     I‘; 
     
    
   
   
    
       
     
    
   
   
    
         
     
    
   
   
    
       
     
       
     
    
   
   
    
        
     
        
     
    
   
   
    
     THE CHAREQTTET‘ 
     
    
   
   
    
     The Montreal 
     
     Curb Market 
     
    
   
   
    
     _~_..-__. 
     
    
   
   
    
     (Special to Johnston k Ward) 
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
        
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
     {m 
     
    
   
   
    
     Sidelights 
     
    
   
   
    
     in 
     
    
   
   
    
     (Canadian Press) I 
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
     )WN _GUARD_IAN 
     
    
   
   
    
     760/1) Q 
     
    
   
   
    
        
     
    
   
   
    
        
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
     ("um 4., Johnston e “'arl1)_ Starks Qlw-nilllllhihvlvilfil 
     
     Qpo|l|lilgil|i.u\\'Last .\iCli Allitlbi .. ..  d o 
     
     Ail‘ lleduc 041,4, aw, 04 0i -1 livil Telephone A2131,’ 121M193 1-3 
     
     Alleg Corp 2% — Brazilian ...  4 
     
     . 13- 13%—% t.‘ ( My .. 7% 
     
     M w» -- a n“ ‘t _ loll: C"... a 
     
     " |‘lln (‘t-meat . .. 6% 
     
     —1‘/-’s (‘an (‘elu Pfd .. 77% 
     
     — V4 (‘all Gypsuur. .. 536i 
     
     ~i- ‘all (‘an ind Aico .. 2 
     
     —- ‘A i‘an Pow Pap .. 72V 
     
     7 — (‘an Steam .. . . 
     
     '+ y. c rul-glusmt .  10 10% 15% 
     
     —1 lColls lael .. 
     
     +104 lirydt-n Paper .. 3 1 
     
     — 1,1; Int Nickel ..  10% 
     
     . - 1m. Massey liarrls .  
     
     ./ L "+13, Ric-Front ...  ,3 
     
     lambs/gel ~ 3% M '-’* W: iii’.".£..‘12i'.‘".: ': i? 
     
     ggfgc“ “I w m“ w m _ I,‘ Steel of‘ Canu a . 2g 
     
     ‘ " lVln Eeo ..  
     
     Byers .. .. l4, 131% 1f 14 “'19 _ 
     
     '5'" A M "  l" u u I lloxrarlan, Quin, Nov. zo-lny tin- 
     
     ‘fmt 9H1" “u. m". my 16y __ (filnadian I‘ress)—-'i‘ilo downward drift. 
     
     l; U,“ A“ “if 13,-‘ 13,‘? 13?‘ + y‘ of stocks was cilerkeil on Saturday 
     
     k “"1"” 1'45.‘ ’“ “ "__ when, after a quiet and featureless 
     
     Egfilrlnasco Wig _ sessiloa of‘ thorstorlk llXshlllnflP, an‘ 
     
     f‘ ' ' ,.,' . - . cqla numlcr o galls an osscs a 
     
     ‘.l""‘_”.n"l°   n“  11% of‘a minor nature. were shown. I 
     
     (Jhuu. l!” ‘ _ 3,; 34,, 35 __1 Trading volume continued to remain 
     
     ‘P1 2m!’ ' w“ 19;.‘ 19,, _ 9/ at a minimum with 3,420 shares sold 
     
     '1“ G P!“ - m." ‘W’? 05.§‘_ l; against 3,4211 on the preceding Sutur- 
     
     (‘iilifl (ins .  45,?‘ ig.,/"__ ,5‘ day and 8,504 on tilo corresponding 
     
     ‘Pr? 1m ‘ ‘ " _  day of last year. The slow but con- 
     
     "'“ “gm ‘ _ iinund downward movement of the 
     
     “ml? 1"“ " _ 5/ wet-k had brought the prices of prac- 
     
     __ ' tlcsliy all issues to their October lows. 
     
     _ completely cutting off the advances 
     
     _ scored during the spurt in wheat and 
     
     __ 5, sliver. During the week losses from 
     
     ,} _ ‘r a fraction to fire points were sustain~ 
     
     " _ {i ad bv practically-every stock on the 
     
     " lloar . 
     
     _ , constructive feature of the market 
     
     __ I 
     
     /‘ was the willingness of holllnrs to re- 
     
     ‘ n tain their stocks in fuco of the weak- 
     
     : “i ncss. Sales volume was at an excep- 
     
     __ s‘ tinnaliv low chb and there was no 
     
     _1% sign of any important selling pressure. 
     
     y‘ H pi-iiitlllrdfiyh; trailing‘ saw “Canadian 
     
     ' " _ lea in ac v ty wit 
     
     I 1055 10% " 3411800 cshanrellvnzlhanging hands The 
     
     ""7"" Mil" 2531' _ price was iii nil morning. off  from 
     
     léiél-lfiiilu" ‘ill. ll? ‘ill 96151352 “Jldily” °'.".i."'ul'§'““l'.“' h“ film" "' 
     
     L"! 9°]  52% g2; 51% 2153-11‘ l-lllalie yofwiyg. BIBIlllil!lIre;'Il'C°tl0Il-:0l3 
     
     ¥4D‘QVR'IBIIIO . gigs W. :  ear-dividend at 10%, up l4 while Can- 
     
     ‘P l?‘ -- '12"? _ ada Cement firmed 54 to 7. Simon Pre- 
     
     .iath l} .- ‘in ‘ ferred. ell-dividend. advanced 2 
     
     17"" “ "d ~ m 1° 7' M‘ " 54 points on a single sale of "6 shares 
     
     .\'llsh m ..|2i71,§ 11% 107i. 1(i%—- is ' ‘ . ' ‘ ' 
     
     a n- . 41 — §i'.'i‘.i‘.'.'.u°“.'.“i‘"..“ 2‘.-"".i‘l°' i.“ m‘ “' 
     
     gs: g gm  20% 20% 2 Gig/z Seven fllfilllllnlifl. dollars Trill; of 
     
     Nay can? ‘w’; 31% 28% 2s“ 2% hélnddsl chanlged ‘hands with no out- 
     
     ~ - » ' s o _ 
     
     N A!“ 5° 3'15 34% 33% 34 _ '55 "Flue nlgatililncai geagilgllalan campaign 
     
     Ilzack Pill‘? .. 4A; in‘ H“ n,’ -' ‘b rapidly neared its end. lip to Friday 
     
     P35“ RMI~ M_~ "a m, guy" ‘é alight title laatdlnnggvillle rail for Can- 
     
     ~-- ~- --. ~l—'- a ns a 
     
     g s ur-w gag; gnu;  381/. - a gbvernment l? ii 05.1.’??? field-l lilfl’ 
     
     I111 C0  J14 Jiu d)‘; 47/1- resulted in subscriptions of 3121.000.- 
     
     Rudlv (‘v -. 8%. 8% 7.5 7% —1 00o out of the $150,000,000 bond issue 
     
     noel]? h] ... 1'1’ 2% 2 2 -' l‘ offellI-ed.‘ Saturday's figures were not 
     
     t» — sva a. e. 
     
     Smlltzfglici  35% 35% 357s ~52 "Sltel-Ililég ‘exchange closed at 84.0742. 
     
     . . .. , — ll tel l ta es unds closed at a prem- 
     
     § Pacific . 3i" 3'.’ 8i ~11 i f 151 _ 
     
     soulll null 10v: 101,; 01,0 0y.- ai “m °- l‘ p“ w" 
     
     S Brands .. 14% 14% l-t- 14 ~11. 
     
     G Eiec .. 33 8-’! 31% 31% —1'~ii 
     
     S O .ofNJ 32 32 31% 31M- $5 
     
     Tbermoid . 21,4 _ ' E h 
     
     u... p. 1. 17% 16% mag-u. Foreign xc ange 
     
     Tex I‘ Rlll . 2d — 
     
     Tim l‘! B .. 20V, 201.1; 201,1 20V;- M; 
     
     i; i~.".“.i“ ' 2i i?“  “i” W?‘ 
     
     c c . l —-» 
     
     ijnlt Mr 13% 1R". 13% 18% —— l: .\i().\"i‘REAl’., Que, Nov. 20—-(Py the 
     
     I "it ("'9 -- "'4 11"- 11 “VI + ‘b (‘llnllllian Prcssk-British and 10H!!!" 
     
     n n n“? " 2H4 2H4‘ 2W5 2175- exchange in relation to tho Canadian 
     
     77 s I 519° 97% '33 37% 27% —1% ll r complied ll the Royal Bank 
     
     d lia , nl . Y 
     
     I“, In , M of Canada, elm-loll yesterday as follows: 
     
     u s “In 535i: "l Argentina, peso, 0 I80. 
     
     0 ‘ Austrlila ' ' 
     
     4 4 35-’: 3%“ Austrln, " . 
     
     “pr 1""! ~ "it ' '—- llelgiilnl, ilelgn, 0.100s. 
     
     “i-‘B Uillfi" 51% 51V; 59% fiiWiih-lifi Brazil, luiiruis, 0.0720. 
     
     “jest A B 1114 111/. 14w. 11 1'— Bulgaria. lcv. not quoted. 
     
     “est Eiec . 33% 34% 321,24 iizllgi-liyf. china, llong Kong dollars. 0.2922. 
     
     _—— PZBISlIIIRlKIVILKlU, 050,232, 0.0343. q 
     
     li-lnl rk rone .'... . 
     
     Fllliliiililtl, ylliilllilfli, 0.0230. 
     
       l-‘rallvo, frilllc, 0.0151. 
     
     Geflilllll)’, rciscllnlnrk, 0211?. 
     
     Great Britain pound, 4.07 ... 
     
     ' (irrccc, tirachlna, 0.0145. 
     
     estefn/Ranch Holland, florin. 0.4030. 
     
     ‘ llullgary, pengg.‘ not quoted. 
     
     LBTl-[BRIDGE Alta Nov 2'1 - hill?) lllgfeb 00054- ' 
     
     - ' " ' Y." 1'. 
     
     Emulating the Prince o! Wales, a ._-,‘;}§gg;,,$§'f-,,‘},,',Z,f 0.023,,‘ 
     
     deal has just been concluded whcre- uzifllfiiglaeiifsllflig-_ 3-7039- 
     
     by Hon. lRobert Weir, Minister of pound,’ 5101i, 0,1305, 
     
     i l 0.00 B. 
     
     "lgrlcmturm “mm” °w“°“ "l "m ggllxtlanllfllliflifulloiillll? 5.0200. 
     
     Mongeon Ranch south of Plncher ipniln, liirflifi, (lion-uh 
     
     Creek, in the southern Alberta ioot- §,§‘,',z°,_';’,a"5f’"f;nn; ofgflm 
     
     hills. The ranch of one and a halt prllxgitplg States. dollar. 15% per tent 
     
     sections is well-known 11f the Wuth- saw roux. n. Y.. m". maul-urn 
     
     exchange irregular. Great Britain in 
     
    
   
   
    
     western Alberta. cattle country and 
     
     has a beautiful setting at; the foot 
     
     of the Rockies within 20 miles of 
     
     the entrance to Waterton National 
     
     Park. ' 
     
    
   
   
    
       
     
       
     
    
   
   
    
            
     
    
   
   
    
       
     
    
   
   
    
     udoilars, others in cents: 
     
     Great Britain 3-5351- 
     
     Franco 3.00 15-10. 
     
    

    
     aiy 5.10%. 
     
     Belgium 13.87. 
     
     Germany 23.60. 
     
     Canada 80.75. 
     
    
   
   
    
     ii‘- 
     
     Dominion 
     
    
   
   
    
     5-Year 5% Bonds 
     
     Denominations 
     
    
   
   
    
     IO-Year 5% Bonds 
     
    
   
   
    
     r ISSUE 
     
     / 5-Year Bonds-WM 
     
     IO-Year Bonds—‘"-99 
     
    
   
   
    
     ties, and s all be 
     
    
   
   
    
     1931 National Service Loan 
     
    
   
   
    
     Denominations $500, $1,000 
     
    
   
   
    
       
     
    
   
   
    
     Interest ‘payable half yearly, May 15 
     
     and November 15, 
     
     Canada of any Chartered Bank. 
     
    
   
   
    
       
     
    
   
   
    
     We invite aiplications for these securi- 
     
     . copies of the ofiicial circular upon request. 
     
    
   
   
    
     Royal Securities Corporation 
     
     Llfnlted 
     
    
   
   
    
     ‘ , Riley Building, Charlottetown 
     
     Telephone 8Z2 
     
     N-lntresi Toronto Halifax Saintlohrl Quebec Ottawa 
     
     ."‘“"“ 'li....l’.”‘°s'l2'.'3'.l...5l,"l5"s'4. lac; “l....¢....“"°'"."il‘..¢.'“"“‘ u... 
     
    
   
   
    
     of Canada 
     
    
   
   
    
     , due Nov. 15, 1936 
     
     sioo, a500, $1,000 
     
    
   
   
    
     , due Nov. l5, 1941 
     
    
   
   
    
     at any branch in 
     
    
   
   
    
     PRICE: - 
     
    

    
     \ 
     
     and accrued interest 
     
     and accrued interest 
     
    
   
   
    
     pleased to supply 
     
    
   
   
    
        
     
    
   
   
    
        
     
    
   
   
    
       
     
    
   
   
    
     PAGE NINE 
     
    
   
   
    
       
     
    
   
   
    
     l Montreal Market Prcozizce Market 
     
    
   
   
    
       
     
    
   
   
    
     (Canadian 'l'rul) 
     
     hi0.\"i‘ill1).\i., Qua. Nov. 20-—-llutter 
     
     Drives advanced while cheese and pill.’ 
     
     illllltlltil-lls din-lined allil piltaifl Ilfii"‘-“ 
     
    
   
   
    
       
     
    
   
   
    
        
     
    
   
   
    
            
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
       
     
       
     
    
   
   
    
        
     
         
     
    
   
   
    
          
     
    
   
   
    
       
     
    
   
   
    
     ion, car lots 12.00; cheese, Ontario 
     
     .0oz.lv.l-1',; viii-vie, um-ln-i- .  
     
     llnil-r, ho. i finest .'.‘ 
     
    

    
     Ira-sh spvrillla lil i-artilll 
     
    

    
     fresh r~.\tl':ls ill various 
     
    

    
     fresh firsia ill cartons 
     
    
   
   
    
     storage extras la cartons 
     
     storage firsts ill cartons , 
     
     strlrllgl 
     
    
   
   
    
     UO TA TION 
     
    
   
   
    
         
     
         
     
          
     
         
     
       
     
    
   
   
    
     i " 
     
    
   
   
    
       
     
    
   
   
    
     1. 
     
    
   
   
    
     (By John L. i 
     
    

    
     Flnr 
     
    

    
     NEW Yfllilu. 
     
     .‘=ii)l‘k nlarilct 
     
    
   
   
    
     lRKET GOSSIP   I 
     
    
   
   
    
     . a Ohio. Bum l" 
     
     .""“.A::°:)l“'d Pr." 13;‘. llllltéfifillify Central and Union: 
     
      Yr i... "ll-The iwoifie were off rouiili! 1 1° 2 Am‘ 
     
     unable to ‘enlarge i'l'.i(‘llll Telephone rcltlillii"! i‘ mmlemm 
     
    
   
   
    
           
     
    
   
   
    
     8 
     
    
   
   
    
        
     
       
     
        
     
    
   
   
    
        
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
     Conversion 
     
    
   
   
    
     . . . -- ‘ Electric and (lellorai .\io- 
     
     hl-ili uncilnnircd on tlw l""‘d"“° "lill Jill. . iz-llln ‘the illliill ls of the Ottubir u» lass, (rPiiLWill  r mm, ymlnn. 
     
     gm k y , A A _ ' ‘ _ v ‘. _ ,_ N _ , ., , . t, l r were about snarl. ii_ ~'_ 
     
     Milli"? .. ..  orlllllnlbhn owlr “t liIONTRPIAlZ. Que. Nov. Qli-Snillr-l  lillzfznlgliifllg"?syf_‘rpo"hzfifirlu“ m‘ "'0 “0 ‘riTlfi-kisllfiilliltiittvili‘glsilllftt of steadiness all llilsruii. Case and AlliPflPflnilflllllf" t- 
     
     Brltluh A... (m _ my; day's brief messiah 0i‘ "i111"!!! 0" lb‘! “ML; ma, r‘ f"?! Mnm‘ “m; o“! _____}_____ ,' the ‘firs, 1...,“- whc" it appeared 1'0 ii llnulo Hlnfl" Y""‘i'""“' F“ "m" 
     
     (‘an Willi,- ,, 1 local exchange will a coulllletcly fro‘ 0 1' g ' I " ,. ., l 11.1 5ll"!‘.(l ill the illiter Rloineatuln was added to the dec m! 
     
     m! f,  ' h h M ‘H, and potato quotations were stem y. l nlltfltl‘, ile - Lb _ V I “we, n mum,“ 1n n“; 
     
     °'i1-$c-'|  7 tureless affair. WI! l 0 N" "i |.~ , 1 nstl-llrizedl - »1( r ll session under the dispiril ily llllrll tlst . I 
     
     . W ii Street lilo '"'“"‘"' t"“'"9h’p3 no‘ p " 0 w - ‘ ii i area would begin H!!! 
     
     n” smn" --  "lél ‘hwvmvnrd flu“ in a lump,- l" “r1018 w“ up n quarter hg influence of tho rails alld the lnar loungdm ll H  
     
     Impem“ n“ - -- 11%| “M”! mtmence on market sommwm’ of a H»... 1t "“ in’ "‘"/ cents a pound. kvt finished from fractions to three week at 32 per rent of capllc y, s 
     
     Illlli 'i‘ullari-o . Rm ’l‘i.ul broad advance in values tilat "Wk ’i‘o retailers sblidsnllt‘ 23 to 24 cents h paints llif. Sales totullull 0.181000. Iirflii "f 5-’ 1mm" "m? w!” flick an 
     
     lat Petroleum _ 1111,] | pillre in October Ilsa now ilel-u ltilii, "m! pr-mt‘ "t n‘ ‘o 25 Mn“ n MUM | Th“ ‘\~_,,,,.l,|l,..| l-r.-ss-.\‘t:llll|:lni Stllt- n! Ii from last uw-ks liifihigP-t d 
     
     lnt Vtiiltios I; 21/_| | nali surrounding conditions are not of Wrp ‘Hml-‘mvnu-l Receipts m“ “wk Imp’; F108,“: “v,,,,,3,. f... no stacks (‘auiillt-nlal (‘liffltlifilifl were slca y 
     
     Moss Minna 23%| l | a nature to encourage a collslrllcth-r- WW0 aamwuixeé ‘Qua 73y, m- 23 paints above the Oc- Gcrlnall ularks lillpflllPil sllcht you: oom- 
     
     Ilm-"nd" " """°ml5-1°'15‘°°‘15-1° ‘um-Kat “mod m m” presenttumefi|kli' ml l'h<- (‘llfifillfi- market. Ontario do . loin-r 5 iloltulll. Transactions totalled llle lltrellzthnof fIJl‘l‘"lI1‘len{Sl'o;t:d ‘m, .ythai 
     
     14h" "m -- “m/Jl | i “on” from “Ind” and ma“! n,‘ “ ' e ciiued an elrhtb of a cent at 0% t- 938000 shares. cernlug crcd repn) r 
     
     E Ill . - Ii ' 
     
     Silerrltt .. .. . fill I Pointing to some slight b tier ent 91' PM,“ wLhlle Quebec cheese wa ‘ new lork Central was bombarded prospect lh t balances remaining a tel I pm 
     
     TMk ""11"" - 5415i 1 l M“ “m”! "5 y“ ‘mdmlgge!’ “y; stltadv at 01/; to 0% cents a prlulm ‘ ‘with selling orders which hammered February 29 would be renewed. "o" 
     
     v I 1 < . ‘I n1’ ' . ' 
     
     ii uiki-r. lllranl 3a,]  ilrikglltkllhlllli" "9 mpm" m" iioctllpifl for the week were 11.015 lma j l it doll-amt’?  ltzgUfilg" Kin]. ‘it’? WHAT n": STOCK MARKET mm 
     
     ca. H orn ‘Ln l K Ivan “Dim” to m"; 
     
     ____ om” farm" “mt may he "Emma tfiiflvfit Prices of fresh 0R5! ho’. ' hit-e approx lllldltlb  ’ ‘M. A l a in“ f’) ‘be’ m. 
     
     . . as Ffliiiflltijillllflfi tohiillllllthlizltliy llfliflliéillli fiffllqgbtlggf-raslllt b4efiingeniiuuottlelltl| P1518}? LONDON, NOV. 2'1. (Carl ditm   rnihlliét ‘1"-:'4“i"z;ll‘ig‘vpst Milton“; fimnimr "t! "éivqlnra: H 3:‘; 4:]: Gov‘ 
     
     tl l ex el fl\\".'ii'( lo " ' , _ \ ' . g v t , l or n e0 lle - l’ r 
     
     Mlnlng  zltw-utl-Ill?» midi... at the prcsrn lime ififlifitwcewxra" JL1“::I-|g:f‘°'2§fr1z5fiféh:: Pres Cable) stepping to me am gwrmwlflllcth '“,',::',1':lcdu,t‘ 42'..'-‘l‘l:.,rlm1§',:.. Qililifill; unchanged -- 1"“ 1a -oposai 
     
     helm“ m” "nsenlm Gemm“ mu‘ qllotrd at ["1 cents firsIts at ‘24 tn 25 o! the British ‘Mme!’ the Govern‘ [ladle dipped ll point to a new liliniln-iTotal issue; traded 000 t v0 p" 
     
     IIUOII. and the xrvwlnlriy lento lwl- Nm, "m, "m,onda'nt n1 n, 00 m". mm, mtends a ‘ in a quota to ,__ _ ______ __ _,.   
     
     "n" .0! we mllwnytun "a; c|o':,";]p"\." a Ill-IZPII. Quotations to ‘rctaile-lm uvrl- ppy g “_  "“fheaf—'gf8y:vér_q““   l1‘ Per 
     
     Illdmdugll-lnnhillllll: hrllrulrléuulu“ uplul "m "n" 10st Week's receipts wtnllv-I h°m°'g"°“’“ when’ s“ John G h been lctureo 
     
     , (Canadian Primal {llgnfigiil renyssuriul: feature is alquitc  flmffu“ mink" w“ “nrhnnzm! mfllll‘, Minister of Agriculture, gn- throughout the 601111111’ 5W6 [hi g muflb 
     
     - u . 
     
    

    
     '1‘0ltO\"i‘O out \'uv "U—(\liliii"B "nlnphitamlllllte llellilvllllllulcel-uqtlllflllulq’; ‘illutvltloiilinliftr s0 Hound ha: helm: 8F- "mlnffld i" the 3W5" °i Cmnmms- advuatmg a quot“ system by w)“ OTTAWA. Ont. Nvv- 27- ‘Bi’ till 
     
     0M8! close); " ' _ ' film-Ml‘... l‘ all: increase ill aellln lrts- '“ ‘*5 ““"'-" 7"’ Q"“"‘° “"‘"“"' n" "' A5 another Iank in the admillistra- a certain Vifi-‘cntage °l Mme grown ' ess ~—R.etirement from ' 
     
     qnloq stock I“ ‘Hovdq .9 ""7 ‘ not g I .'l.’i cents for Quebec green ulnulltailla p dd d “horny Canaan“ P!‘ ) 5 W)" 
     
     ‘25ll0'.\~-lll0 .. .. .llg'.l':l"l".lll"/.l In". uua nr. to m .00"; for xl-w nl..u.ua.-l= tlolrs new agrarian lviicy, Prime swirl would be a e “mp t m, Government service of O. l m and 
     
    

    
      1.1;‘, " 11")“; L03 One favorable fcatllraavhlch suagostll  gfillllnllllltllllalltalllllltwileyrllllnnpllllnkl, Minister Rrnlsay MacDonald Silid a t0 eVCTY bushel 0f foreign Whih Flnnjg, Dinwibl‘ 0f the Northweal o! the 
     
    

    
     iollllillllrrazuu ,_ j _~ __  llnidlllsencnlalllll-lflrlltengoélidniil; nonlnvgrli, \\'<‘l'i‘ urn t.» 1o cents. financial resolution, authorizing clls- for milling ltlilriimfie: ‘culture Sam Territories branch o! the D9011???‘ m, ‘p. 
     
    

    
     '. llurt of the public. wilich despite tin‘ nllscrlnnaunoos i°m$ duties ‘m "Frlcumlml Pm‘ The Nnms er! ob gr d flecuvelment of Interior and M55“ L‘ T s lear- 
     
    

    
     2.‘l00,'\".:lllusa  tots: i052; of, the wggivubcalgg: ‘is 51's“. “OYTREAY Q N o" B H ducts. would be introduced in the the quill“ Wm“! e ma‘ ° e Bur-wash, prominent Arctic explor- of u“ 
     
    

    
     W | ‘ l l 1, ‘B, . u. — ii P_ . _ 
     
       mQaYQfia,’ river! to theunrrauonod‘ (‘uulldiall lynsterladflo. 3 (g1: oats. Canv- I House next Monday. l0 next Year’; GNP. He added 3380-! a and investigator for the‘ D9. 
     
     iuunhlvlluulul-lu ffézhtflinz:Qglhxxprtigt"hi: enzyme": aluuqgrlvgitlll-rn nnrlérilngoivgttqa- fiifqflr-Nftz» Resulfng from the anti-dumping the governmenthad deoidgd toin partmmh Wm m“ pm, sham, r c°m_ 
     
    

    
     '7?‘ ilrill‘. .. . - ‘ - ' “ _.‘ . _ ' - ‘ _' ‘ _ {,0 uee m- _ 
     
    

    
     5§gill:~‘|li>l_\"u|l  llllhkvlcgll“: ggiilgnlrlfintpilffihnvlg"  lrllriz-Llknalnflgxg}  ,-‘l‘.'.'lig‘.flfi'oillel‘. irgisiatlon llillitlll Elflplrlfidt tariffs a fllzlguczricmrizigrilon agent!” a? Both omcers, it was imrned allies; l “w; 
     
    

    
     f.‘ lr- inllyn -- ' ' ‘ " ' ' .. ‘ _ ‘ i st el-t l .d i - D 5 3 ' i D oem 
     
    

    
     3,._{H|,,,,,,,,_,L., IIPHQ!‘ in sentinlant, provtitllng as: it cats, algal»: v .-:_4o-.1...o_ ‘any, “up. 81in c an manu ac lrr m Hem of cultural produce" by ly today, will let re on e Brlum‘ 
     
    

    
      all‘. 2.0210.‘":.r:.::l“:...lll..".420 1"“..?.'..;i.".‘.‘1..“damfTSI 1- PM Bus“ ‘ante W” be" ' , ‘j H, H, =1 not ..... u. 
     
    

    
     ';‘%§§§f,‘ff“},,,',,',   ilo overdone. 00 lbs. 2.00: hay no. 2, per BKHQHUB m? 50319 “m? for 9' 771993‘ means o e ca‘ made a 
     
    

    
     l;:l:'".'l:...-.~_-;;  ~~ ~ ~- —— n w- 
     
    

    
     Ziililhicilltyre .. ...| 
     
    

    
     1000M i i ... ... " 
     
    

    
     300 lilllll-cnlzarp .. .. friend’ 
     
     iolnollur-null ..  d. "bui- 
     
    

    
     ILDOM ss . .. ... , 
     
    

    
     MONO and! ..  ' l“ m“ 
     
    

    
     zotoogl Colon}; .  
     
    

    
     2 ‘Ilaa Antono  
     
    

    
     IEfiUlShEIIIIC   m“ t° 
     
    

    
     iiimlfiiscoe .. .. .. 5- 
     
    

    
     fliiiflfiiadacona .. .. as p0 
     
    

    
     200Sylvanits ..  "X1 °°"' 
     
     2000T0shota   
     
    

    
     8SOTeck Hughes .. 5 h" by 
     
    

    
     HOOIJMCGG Kiri: ... 
     
    

    
     500 "pond  _ 
     
    

    
     2700Wright nul-  swkes 
     
    

    
     Sales missing. ‘ q Offs l0 
     
    

    
     UNLISTED ‘ Fund‘ 
     
    

    
     2 items 
     
    

    
     1700IAi1ana .. .. .. oil/pm lm ' w h 
     
     lzfinglg iulzflzllul-l . .. .10 {.15 1.1a a "ti": 
     
      . 102$ 10._:'l 10.25 1] 
     
    

    
     20o (‘al Edm .. .40 [.40 ‘l .40 , "m" ‘v 
     
    

    
     IQOOEIdnTIIIIO .. . .93 ‘.90 :1]? 
     
    

    
     33511 l8 Bil . 2.9.’ ‘$.91 ‘liil ‘ _ 
     
    

    
     a0 w» on j .. 11.001 11.00! 11.00 i? sup" 
     
     140 Nickel .. .. 1000i‘ loan; 10.00 0r (ll-eat 
     
     Sllii Pet ... . 1l.'0 11.70 li.."0 _ 
     
    

    
     1000 K-Hiiillzll .. .000 .00’ 00' 5 5mm 
     
    

    
     4500Nordon ... . .17 .17 .17 ’ L50 p91‘ 
     
    

    
     000 Pend Ora .. . .88 .83 .83 _ T 
     
    

    
     ftiii10iPon Pete .. . .02',1| .n21,4| .02“ "l?" 1' 
     
    

    
     l002|Veatures   .48 [.46 1.40 I 
     
    

    
     gum; 7e among 
     
    

    
     u ' I i - 
     
    

    
     liiiflllinhjo ..  me Br 
     
    

    
     0000mm: .. .. e Cham- 
     
     ilitoiitiiilrolvniee . l I I I ' 
     
    

    
     2.500191‘!!! Kirk 
     
    

    
     Rl00iDom Exp] - 
     
     Zlimifirozclie u n‘ 
     
     lame "l" ~ - 
     
    

    
     l lago . . e v 
     
     dune...  HE National Service Loan 1s a great national cHort by 
     
     a . 
     
     y Canadians for Canadians. You can do your, part by 1 z me 
     
     G ' E ° ' ' ' - ilconard 
     
     m!" xPQTtS buying National Service Loan Bonds. By doing so you will . 
     
     , a e ' I 2 
     
     be serving Canada and obtaining for yourself a safe invest luring: 4 
     
    

    
     Wi."i\'ll‘l=1i‘.. n“... Nov. 20—(B_v the ' ' ‘ I 
     
     (‘illladlnll Pressl-Whcat traders ndnllt-   3.     n Wfliyh 
     
     ed In “uni; and dsee‘ ‘attitude l“ the \ulay and 
     
     gran pt are o ay. s a l-osu le , a Sullivan‘ 
     
     l arkct '0 si w ifnir all prior-s 1 and cgflgtfufitlve 
     
     £10,... ,,,:‘l‘,_,,‘.‘,,,’},? ;‘.,.,..“?,, .4 glmfi... ,,, .1, The proceeds of the Loan are to be the most senslb c h. 
     
    

    
     h gher t an Fr in_v's inal aures. - ' ' 
     
    

    
     “Novclmher 95.... a 5m, unulu a. used to promote the economic wel- use to which a Canadian can put 1S . Ryan. i 
     
     eceln ler at 1% to 51M. was l,’ owcr. _ _ , ' B n8. 
     
    

    
     Sirlivflai: 02 was 1,4. um...- lliu July fam ofthe DQmlfl10fl-—Wl’llCh means money today. And as an investment, zckeyrion 
     
    

    
     on c unchanged to 3g higher. ‘ 
     
    

    
     ram was a littlmb ttcr export - u an g r131 attrac- h. 
     
     trade worked during ‘lfiillhlly night alld yOll 311d your friends and all YOU!‘ thc Bonds OE-cr Yo q d ygcgfm 
     
     soltiiuont app ed t b lno f ivllli- . ' - ' 
     
     1y.‘ Prices opeellierd £01,303...- llllt rsuffi- fgllQw-cflflfldlaflS. tlon- TIN)’ are the safest and’ soun est 
     
     cient recovery was orthcoming to leave . - - 
     
     the mall-hes fracitirlllaliy iletter at the  Of Canadian SCCUfltl¢$"'b3-ckcd  at, Galiimi 
     
     ease. ra era nd catcd a desire to . . l . . . 1 
     
     uulnuxuy from it‘... utuuuyhluuulll‘... hst" There are already indications o ct the whole wealth and integrity of the  2 
     
     aw c ng opera nns o e r nan , . 
     
     .1502":.l"ll..:r.:l:":':r.n.r:";::..ll:% W’ ‘ms “hnd- T“ ‘“°°°” °‘ ‘if Dominion. They can u. .01.: for cash _ 
     
    

    
     o liiay and July. ' ' ' . ' _ h bore 
     
    

    
     Foreign news was mixed. n was re- Loan and its expenditure in Cana a at any time and at the Prcscnt Pam s e 
     
     parted that Germany had lowered the , . H f _ _ , Ohefilul‘ 
     
     tariff‘ on llt\,lil'l:_\' liliil nothing ‘twill: nmn- Will IIIIdOUbtCdIY qlllCkCll thC OWO they W111 Ptovldc an laconic of ovg]; even ‘has! 
     
    

    
     Dill‘ W I cgarl fl WiFfl HI’ l. 
     
    

    
     n ti 0m» lad r h t 101'! ' ' ‘ "" ' ewsssui- 
     
     W211} '.'.’:l.l..'u:r».'Illwfuli’? uu.l"§.§' on Canadian business and glve fiilwwcd five per cent. an unusually high 
     
     rye, on a nul bar ay. - . ' ' 
     
    

    
     Cash wileat. lu llzrht trade, closed ii confidence to Canadian trade and mmrn for an investment of this kind. m“... was 
     
     fraction higher while coarse grain‘fu- “ed w 
     
     lures showed fail- gains at the close. commerce _ h ak .n a one 
     
    

    
     ' ' C III 1 t, ll he! 
     
     cm“ i h ~ sell-c fins c ancc "01.: P ' “t. ufreguentiv 
     
     ' "F" W’- "Vvifl From this aspect alone, the purchase national effort-wit every mv 
     
     s. 
     
     “,0; Doc. 000.; liiay of a National Service Loan Bond is mcnt advantflgi? t0 Y°‘1l'5°1f' S htliting: 
     
     m... allots; Dec. 3053B; ‘lmic e 
     
     le‘s cm - 
     
     z '93 
     
     casn cLosI l i  S c d o and n. 
     
     Wheat Yo. 1 hard 011,4; no. ‘l nor.      n ‘amsay’ as- 
     
     . ; no. L’ l-ov. .'.i»":!.; no. .'i llorkhléfiésao. n. REV- Mr- 
     
     4 40; an. T. »!iI/; nu. ii 40V; ee . 1 _ _ 
     
     ‘",‘,"“, “Q "‘.",l' '.',',"-,gi,"i7,,,, ., ,- Q. Send in your order now. Any branch in Canada of any chartered bank or any recog- jieeigoii’: 
     
     ns~-.u.‘.‘.  .. . . _ . - f . 
     
     m“ ,1" "' ' """' "§"’§.§."°' 1 t": 2°‘ mz" ed dealer will supply detailed information and the necessary application forms. 
     
     no. 2 o I'll-ii’; m. .. /; trac 3 . 
     
     "Dari m lflliilifl grades“: 2 ray .55.]: _ six of her 
     
     . ..row ex.. .. . .._. 
     
     Other grill -= w. a c. w. any: no. - will Irvine 
     
     c a uh 51a. uokllagx u‘. sail/fin». 0 ICE 5 YCQI‘ 5% BOfldS,  and accrued interest rmedy‘ Pr“ 
     
     . V. 5;; true .   z 
     
     . ' retest zierson. H61‘ 
     
     ~ crllcaoo  YCat 5% Bonds,  md ‘ccmed m ' mm" Km 
     
    

    
     CHICAGO. llL. ‘Nov. 29-—T.nfn raliirs Cl‘ 111611101)’. 
     
     in grain railn-s lifted wheat yesterday 
     
     to above l~‘ritla,\"s finish. ill the fillal l l  
     
     hour, the markets nlct with sillilnrn G0 V 
     
     resistance to selling pressure. acilre ‘ . d  
     
     buying powérr developing from slnllli- _ 
     
     lag orders o purchase on l] v t lls. ' F 
     
     iifost of the recoveries were z-lllxudiinf’      
     
     tor trading in stocks had olllied for 
     
     the week. A late stimulating fil"ifll' Cove, N11, 
     
     was news of a hot wave in Arlrnniilvw. w nervrmh 
     
     with temperatures of above 100 lllr»..‘- Q n“ “bk, ‘c 
     
     oniag serious damage to crops. Q ~ 
     
     ' Wheat closed irregular, vcuryiaa , , 
     
     from IA cant off to 1,3 gala. roulpnred vlth pimples 
     
     with Friday's finish. corn unchanged lg and (m- 
     
     to ll; down. oats at 144/; drcilae to M. 
     
    

    
     111913;? llggogrovilions unchanged to ‘m: Sty 13:: 
     
     ._..._.._________ _ 
     
     ave entirely 
     
     (locals! to Iolmlion A Ward) , 
     
     "In Ask»! ' ' n Book: will close 
     
     w: rLoan  i037 lotllnllo-llln DEPARTMENT Q11 Emmm Tb: subbscnptm . b 11d a. only in The 
     
     a o y man .. 5C1‘! 
     
     vm", Man __ own" l when t e amount u‘ u: 
     
     Victory Loan .. 
     
     Renewal .. .. 
     
     Refunding ... 
     
     Rcfunding  
     
     Refunding  %~ 
     
     Refunding  ~ 
     
     Conversion ... 
     
     Conversion ..., .... 
     
     Qonversion ....