help hha csra.af .north side of St. John's. subsidised rental housing. ,. 1 ment strurt urns. are Canada. houses with courtyards behind thcm. an area for children to pin)". and a routing scheme da- atgnpti to eliminate traffic prob- it-ms Thr lrripr.-ii gm:-rnment proves 7-5 pm (Till of the cost of the huglgimgu, ihc rmiincc 2.5 per cent. Thw municipality pays for W-pr-it, lAHl9l' and sewerage. CONSTANT DEMAND Agrccmenls hate been lilllgd. tho mayor says. and the city council IS uorking on designs lo? ihc unricrgrnund serxires. Bulld- ing will start when the lPl'ViCC8 are finished. Mr. Mews says l.40fl families in the eitra npidiy-lncreasinl Pollulation Can- trai Mortgage and 1-Iouatu'a his- geat. urban redevelopmmt scheme Q will soon get unds way on the lumbar of housing units built in Joha'siby the federal and The Newfoundland capital's new I in c e rt of a federal-provincial-munie , pal plan is along the lines of pro. emafiantly offset by the increase jects completed in Toronto and ti underway in Montreal. But Maytr Harry Mews says that when the about LII) new dwelling units 155 housing units. the majority of Wire built them row houses with some apart- John's. In the same period the finished lmbillltion rose from 44.600 to 57.- there will be nothing like it h Ml. "Foe avary home built We have an additional 45 people." he said. "so we are still left with the demands of overcrowding, and that is why new housing has There will be four blocks I - . Rental Housing H To Help St. John's Families ST. JOHN'S. Nfld. (C?) v To St. John's load, Iiewandbetter I. John's. and new and better accommodation. Completion Ill. But ire building program governments on. Mr. Mews II.V done nothing to clear the slums. clerance begins weeks. Plans were within a mpleted i federal ance scheme would cost mar area . tsusuiactwmiu-ingtoeaome h and aroudd St. lle said the first phase of work on an area designated for alum 1 Q: Mr. and. Mrs. Aubrey Morrcll. St. Martin s New Brunswick, are 1964 b t th ' . - u T mum" had been H lhr guests until Tuesday of Mr. ml 10 get title to the land ever - provincial- ' Project, the slum clear- than 8500.000 and would result in brick and concrete buildings In, house 50 families and playground, space for the 000 children in thcj of is Lenafiaruiiaalclama. wanansatia. rename Page 8. The Guardian Monday. Soot. 10.1956 HAPPENINGS , In The Baby's tax alaimntltnal could dian Glen woouey. who cl-l under November of that year- The revenue devlirl-1119'” mwood. have had Mr, Parent's bro .. Fredericton. and Mrs. R.C. Parent, Ravenwood ties for Mr. and Mrs, Mrs. l Bruce. W.T. Weir and Mrs. W.G ELLEN'S DIARY The Quccn's County Plowing Match-this was its day. The time, as yet only at the beginning of - harvest was well chosen: the day ideal. cut from September's choi- cest fabric. as golden as the sym- bol which among nations in their plowing contest is awarded the winner. it was the Day. but at Alderlca. where preparations are now being busily made to take care of the harvest. we could appreciate there was little time today to be given to pastimes no matter how interes- ting or entertaining the prospect. Concrete foundations, substant- lal monuments to the wills and skills of the builders completed at one barn of the place. a simil- lar work was to be under-taken today at Rob's. At breakfast James talked at it. "We must get that done. and by rights the gransries floored new before we put the binder in I field." With the harvest now about ready, who of us on the distaff side of the family. what frail creature of the rib of man. would presume. to put. a delaying factor he the path of masculine plans no mat- ter what fascinating distraction ba- ekoned? "The Plowing Match will never be nearer us." someone comment- ed, "ifs only a few miles away." The wary location drew us. friend- ly and happy it called a "Wal- rome” over the fields. The farmers went to hair work of morning, the bolidayiu ahild- Pen with them. unticipationa bani on repairing. in a cozy fave ihcrc. the playhouse Mack and Gagc had built. in a Saturday ab- aorhtion and which since had come to grief at the inroads of the pas- curing herd. Stouter stakes must go into its construction "to hold her" Mack decided, even though To The Plowing Match "well find something for do exactly as we say" is, to work-to brush the floor tidy the house. you must do ex- actly what i say-remember" The day kept them here with time out only for meals-busy happy hours spent out of doors in the loveliness spread about. "I reckon, Ellen" James came to his armchair in a thoughtful mood after dinner. ”we may as well go to that Plowing match. I know there's plenty work to do at home but it will be finished in goodtima without me. Yes" he said rising ”llll go and see if Jeanie can come too"-It is among our happinesses as a family that James, its patriarch treats his daughters-in-law as blood-kin wal- ooming them warmly to it's in- terests, we believe in place of the daughters it was not our good for- tune to have. So presently out along the hill,' mug is the little truck we went. out into the blue and gold of the September afternoon. Until tomorrow -- -- - Diary Good-night. party of builders. her position vague though Mack assured her, you to do, but" he stipulated. "you must "Yes" she agreed with a chuck- ”and when it comes my turn or Mrs. R.H. Barrett, 10 Grafton St trcal. day morning for New York City. an route to Florida. Mr. Neil Bar- rett leaves for Halifax to begin his engineering studies at the Nova Scotia Technical College. Mrs. W.E. Barrett and her son. Mr. Neil A. Barrattt have been the guests for the past few days of Mrs. J.S. Maclmd. Hunter Blvar. Mr. and Mrs. Arthur Perkins and daughter. Lois. of Jamaica Plains. Mass. have arrived on P.E.l. to spend the remainder of their vacation in Springfield and vicinity with the Hickox family. Before coming to the Island, they spent some time on Cape Breton Island at Antigonish Beach on the Cabot Trail. They were accompan- ied from Boston by Mrs. Perkins' nephew, Franklin Hickok of Glen Valley, who had spent two weeks in Needham. Mass. the guest of his cousin, Billy Burkhsrdt. Mr. and Mrs. LC. Parent, my. their guests, 8?. Hr. R.D. Parent and Mrs. Parent, also Mr. Parent's two sisters. Mn, Adel. bert Grant and Mrs. Fred Younge. Mr. and Mn. Allen Laaman. Hal- e ifax. have been the guest; of Mr. and Mrs. R. C. Parent, Among those entertaining at. supper par- Leaman were Mr. and Mrs. R.C. Parent. Sub-Lieutenant (S) and Mrs. Al- bert Allen. Halifax. are the guests of Mrs. Allenls parents. Dr. and Lieutenant Allen is returning in September to Cornwallis for a course. Mrs. Allen will join her husband in Cornwallis. They will leave early in October for Mon- Neii Barrett of Ottawa have spent? and Mrs. R.li. Barrettt. ifl Grafton-l Street. Mrs. Barrett left Satur-l Mrs. James Nicholson antartaiurfgd Lucy Nisbet, Ln, 5". ing the shower gm; Mm assisted in serving lunch, River, has been a pecialiy fine tenor voice. He is . ll??- Mrs. W. E. Barrett and son. Mr.i tion. Mr. and Mrs. they visited with Mr. Parkmants dlllghter and son-in-law, Mr. and Mrs. William Horton. M an informal gathering of Prince of Wales College teachers 0!! Friday afternooon. good-by; were said to Mr. lvan Dowling. who leaves shortly to join the staff 0! Cpllese Militaire Royals. St. Jean I. Quebec. Mr. Dowllng, who was P0Dular both as a teacher and as a student at Prince of Wales College, was presented with a gift by his fellow teachers to mark the occasion. The Regis- trar, Mr Gordon Bennett. speak- ing on behalf of the teachers ex- pressed regret at Mr. Dowling'a departure. and also took occasion to welcome to the Staff two new LET'S gr By IDA IAILEY ALLEN "There is much more to losing after the demands of an active Sunday. he admitted to being a bit tired and not in the spirit. as' he said "to swing an use "at such work. Granddaughter who now must. a whim of theirs. was pleased.- T-DAILY PATTERN weight than eating a so-called re ducing diet." 1 remarked to the Chef. "First, comes a amount of exercise. "Next." cut down the amount reasonable women-like attend or remain awn)” of salt usually taken and increase NOITI illcll Willi-Sll P'"l'8V0U" ll,the amount of water drunk. "And last. take the right foods to he lnvitpri to make one of the. in ind."-Q gdgqugtg intgstingl ae- ' ' ' tion to carry off waste." Many reducers try to Ill 310" Diet Alone Doesn't Reduce The Weight Combine M a. diced. cooked smoked ham. 4 chopped hard- eooked eggs, 1 c. small-diced eel- ary. 1 tbsp. grated onion. 1 tbsp. pickle relish and it 2. French dressing. Bland with cooked salad dressing Refrigerate 1 hr. serve is naata of lettuce. Gar- nish with sliced rad radishas. Serves 6. MORNING SMILE A lemon sher or tea or milk. The Chef": Ham and Egg Salad roughage food than the intestines can stand. For these persons, it is far better to use more aoft bulk in the form of cooked greens and other cooked vegetables: stewed or poached fruits with little sugar "She actually asked you what your husband did for a living" "Yes. I told her he had his own business and spent all his time minding it." ' b .-. Miss Joyce Wigglnton MIDI Frances Piercey. IIUIIAY IABIOUI. VJ. PlYlD.l I penny for sin d shoe. district for the Salvation Army. The monthly "Penny Auction" was held with Mrs. Jessie Cnndon don- ating the prize and Mrs. Harry Reid winning it. Delicious refresh- ments were served by the hostess assisted by Mrs, William Dunn. Mrs. Annie Kennedy and Mrs. Har- ry Millnr. WARSAW. Poland (Reuters)- The Polish Government Thursday blamed the government of West Germany and the United States for the death of two Polish Jet pilots who it said crashed after colliding with a "free Europe" leaflet balloon Ans. I. at easily digested. really ripe fresh fruit. .. "Oranges should be a staple part of the reducing diet. There are only 70 calories to one Cali- fornia orange and it contains the day's recommended allowance of vitamin C. '6 the day's require- ment of provitamin A, plus cale- ium. B vitamins and the very nec- essary protopectinr and bio-fls - onolds to stimulate intestinal ac-. KEEP lN TRIM B! IDA JEAN KAIN Once you've made up your mind to slim down. it's only human na- ture to want to drop the burden of weight with all possible haste and slip into size 16. But there's always the question: how fast is it safe to reduce? For most folks the answer is: as fast as a sound. scientifically planned reducing diet allows. And what does that mean? Well. na- turally it's never safe to reduce health and vigor along with the excess pounds. So. to safeguard health. a diet must include high quality protein and enential vit- amins and mineral salts and lit grams of carbohydrates a day to slow down a too-rapid buning of hats and pevent acidosis. in general. such a diet adds up to 1000 calories a day . . . any- thing less should be prescribed by a physician. If you are sedentary or moderately active. you may expect to lose I to I pounds a week on a man calorie a day diet. tioa. "A whole orange. peeled. sec- tioned and eaten with the adher- ing white membrane an hour be- fore aach meal. offsets that let- down feeling. It duils the appetite because of its soft bulk and stimulates gentle intestinal action. "list an orange before retiring, tar no one should go to had hun- gry. especially when reducing. Otherwise. continue with what I turn a sensible reducing diet. "Have a good balanced break- fast and a hfgli-protein lunch and dinner. But leave 1-: of the food untouched. if in doubt, ask your doctor." Tomorrow's Dinner: Jeuled col- aollme: New England baked beans: loston brown bread; ham and egg salad; cantaloupe with bat: hot of iced coffee COOK'S CORNER Dieting Should Be Fast As Scientific Plan Allows mat weight later on. on a safe reducing diet. she has to stay with it long enough to get a running start on re-education of her food tastes. 3 pounds to lose. A pound a week is a safe but for her. That allows to to It weeks to get a firm grip on good food habits . "once new trenchad, she is more likely to ban has weight normal. Mark Flowers "In Braille ' Nobody. of course. in fad diets won't do a thing to maintain nor- The excessive overweight has everything to win by losing rap- idly. The sooner she sheds the ex- cess burden that can play havoc with heart and other vital organs. the better. But even at a fast clip. The story is different for the ”lighter" overweight with 10 In . and food habits an en- Mrs. cently at the latter' r.: we Inlrtment in gullldcfhgfy rlsif. Forbes read the verses aecofallizln?-V art Mayhew and Miss Velma niiiiiii Mr. Elmer Nich lso , . and Mrs. F.E. microbe?” Alberta Bible Collese in Calgary. Mr. Nich- olson is the possessor of an .3. member of the Tuxedo Church of Christ Choir. Mr, Lloyd 11...,” 15 the conductor. Along with his cat. . lese studies Mr. Nicholson has been studying piano. He has been on MI in many Plrta of the Unit- & Sill-25. especially Oklahomj and Kentucky. Mr. Nicholson will be returning October first to Cal- Mf. and MN. 11.3. Rankin and daughter Caroline of Sewsren. N. .i.. left for their home recently af- ter visiting Mr. Rsnkin's brother. E. II. Park- mlll. Mrs. Clara Gordon and Kent Ind Nancy Clarke have returned 1 home from Nova Scotia, where The regular meeting of the Wom- enla Institute was held at the home of Mrs. Newton Hicken on Tuesday evening August 14. Thirteen mem- bars responded to the roll call by Two visitors were present. Collec- tors were appointed to canvass the N :h'lac:eiotb. nygnm: lllaiatllrl Woolley was entitled 'Fatl'ier Has Tax Alternative - (CPl- The income T0ltON'f0M”d II” when .l mean a saving ofthousands ofdollarsforCana- moon! i there. The board upheld In IuI:g;'lu'g,' asection of the 111601115 Tax Act which say! 1111'! ”'"'P am, 3. pennjttgd for any child not Pvgylougly eligible for family -1- "' t ed hi claiml inM1lis4wt3guT:is eclnauedhteh Show "ii re-' jected his claim on the KN"1"d5 that his ds'Juht"elW::yi:L”l,lZ:'l nnc . - M fmuy ' W only to 5150 acernptton in addition to a 858- 0nlY- First Year. Inonth left artered lpealedtheruitng. ucuonsscouneut fuiiexemptionwaapannittad for ababy bonus.' t ET: babies worded. gave an Individual choice of the full part exemption if a some is claimed month! allowaaeals-aam aeountant Sy- aumw.wum.tg'- ,schildnotprevioualyqusli.thd'u Th revenue dapartm t said the soectioa applied only T: immi- , and not native- The appeal board. however. ll ruled Thursday that the act. ass a exam thin. or allow- This applied to the first year lDbul:le Ring, Ceremony” At St. Polaris- 8t.Pei.ar'slsyChurehwas&e seaneaf an informal summer wadding.wban hlaryCannmNo- llr.c.A. ny was parlor iinezi by Rev. Father Sylvan Gal- sn . The bride was given in mar- rfalfebyltarfather. Hbeworaa ba erlna length gown of white ay- lon over taffeta with fitted bod- ice and bouffsnt skirt. Her finger- tip veil fell from a baaddnas net trimmed with seed pearls and orange blossoms. she carried a Double Wedci Ange Larsen. Mt. Buchanan I Pinettc. Bridal Chorus played by John Macwiliiams. at ih C d” N ' ,- '. t-h'n headdress and shoulder B an um um”! Fxmbl lllerliiglhlvgeils. They each carried a bouquet of pink carnations. Bessie was attended by Mrs. brocsded matching bolero headdress. sales in a frock of pink nylon. ie as best man. sister Mrs. Maurice loss as mat- run of honor. Mrs. Inss W0" 3 floor-length gown of pink net and lace over taffeta with matching bolero and headdress. Florence's Historic Belfast Church i - Church. bridesmaid was Ann Murchison. 5L "”l"” Pmhbytman who wore a yellow floor-length gown of net over taffeta with headdress to match and acting as flower girl was little Marilyn Belfast. was the scene of a pretty double wedding on Saturday. July 14th at 5 o'clock when Rev. Don- ald Nicholson united in marriage ' Bessie Marie and Florence Bor- nice. daughters of Mr. and MIS. John Ellsworth. son of Mr. and Mrs. Charles A. Morrison. Rose- berry and Clarence Boynton. son of Mr. and Mrs. Clarence Panlon Bessie, given iin marriage by her father and Florence by lief eldest brother, Harold. entered the church to the music of Lnhenglrviln s rs. The church was beautifully.”- oorated with baskets of mixed Colin MacColl as matron of honor. Mrs. MacColl wore a yellow floor- length gown of not over satin with and bridesmaid was her sister argaret who wore an aqua floor-length gown of net over taffeta with matching head- dress and acting as flower girl was little Barbara Ann Morrison gr John was attended by his brother Laur- Florence was attended by lief ing Al MacDonald wearing nile green ny Ion. Boynton was supported n'his brother John as best man. Us Adam Wight. . The flower girls carried bask bridesmaids and matron: of hon ored mums. Eldon sang very beautifully of the register. For her" dsughters' lMr. RB. Rankin.' Summerside summer flowers and guest pews crelie with White 30Ce550Tl05 "lid roses. East. were marked with miniature flow- iwore a corssge of white carnat- ars tied in satin bows. out. BUILT LABBADOI RAILWAY Mr. and Mrs. Hm-at-9 MM-ya,-. Both brides looked charmingginy Mrs. Panion wore a tircasssof - g I the Past week the guests of Dry lune have returned home from Tor-'3l"1ll8l' "00T'l9l1tlUl KOWM 0' Wllllel l"”l””N' "-"0" with. no” chm" MONTRUVJ '(-m r- lief-'l0T onto where they spent some time lace and net over taffeta Wlilllallfl white accessories. Her cor- MRCNNL whn .11,-acted construe. sage was pink Carnations. Mrs. Morrison was dressed in grey and navy with navy acces- sories. Her corssge was Pink cnrnations. Following the ceremony p re- eption was held at the Queen Hotel. Charlottetown. where ap- proxlately one hundred guests en- Joycd a delicious turkey supper. The bride's table was centered with two three-tier wedding cakes topped with a miniature bride and mm. During the evening the guests enjoyed singing and dancinil 8"- ar which the young couples left no a honeymoon through the Maritimcs. Congratulsfnry telegrams were received from Clarence and Neil Panton of spragge and Toronto. Ontario. Wed At Rockin Edwin Austin, son of Mr. and Mrs. .S. Rev. .l.l't. Williams performed the double ring ceremony. Th e church was decorated with bask- ets of summer flowers and the guest pews were marked with white satin bows and pinks. Mrs. L.N. Draper was organist and Mrs. RE. Beatty was soloist. Given in marriage by her isth- er. the bride looked lovely in her floor length gown of white nylon lace and net fashioned with a very full skirt and high neckline with tiny covered buttons to the waist line at the back. The long sleeves came to lily points at the wrists. her three quarter length veil fell in grace ful folds from s brimnrad head dress at stiffanad lacs. Her only jewellry was a single strand pearls and matching earrings gift of the groom. She carried a bou- quet of red roses. Mrs. ltichardl Cox. Moncton. N.B.. was matron' of honor and wore a wait: lengthl gown of yellow net and lace with matching hat and mitts. She car-I tied a nosegly of mauvr and yol- low 'Mums and white csrnstions. The bridesmaids were Miss Shelia Chamberlain. sister of the groom and Mrs. Douglas swinimer. of Falrvlew. N.S. They wore similar gowns of nylon net and lace in wait: length with matching flow- ered bandeaua and mitts Tlic inr- mer In pink and the latter in blur. They carried nosegays of pink and. white 'Mums and csrnatlons. Lit-l tie Miss Jcinel Smith. daughter of Mr. and Mrs. Owen Smith, made a vI'iTISOl'I1Q flower girl in her; "00! length gown of mauve organ-l dy and lace. worn with matching bonnet. She canted s n y or mixed urnations and lily or in. - Rot-kinghun, I'll best man and the ushers were Lt. Cmdr. Chsnning 1). sum, brother of the bride. Halifax, and bariain. brother of the Tour Through Mciritimes A pntb summer wedding was solemniaed on July 7th. 1956: in Rockingham United Church when Mary Elisabeth daughter of Mr- and Mrs. Clarence L. Gillir. Point Prim. P.E.l., became the bride of Edwin Cbamb 1.1.-. Rocklnshnm. ghcim mung iustl and pink acces- :1-ias,.hsr aorsage was of Pink loses. the groom was in charge of the guest book. The bride is employ- ed with Simpson-Sears. Halifax. and the groom is employed wi h Canadian National Railways. Rock- lnghlm. Prior to her marriage the bride was tendered several showers. and received many lovely gifts. Following the reception the young couple left on a honeymoon trip through out the Maritlmes The bride wore a blue printed silk ahantung dress with white hat and accessories and corsage of pink roses. reside I ' "ngham. NEW ANNANW Mrs. Lemon Mcwliliams. her daughter and son-in-lsw Augustine lcove visited at the home of Mr. I and Mrs. John Mcinnls and fami- lly on Sunday evening. Mrs. James Mill and son Jimmie has returned home after spending a week with her sister Mrs. Lloyd Crozier and Mr. Crorirr. Fsirview. N.S. Mr. Garth Crozler. Falrviaw. NS. is spending a couplr of weeks holiday visiting relatives and fri- ends on the Island. Mr. and Mrs. William Johnson and Mrs. Lewis Mouse. motored to Lot is on Sunday to visit Miss Etta Huicheloll 'snd hrother Cal- vin. ' Walter. Gavin and Alvin Cur- ie! are employed in Bedaqua at Campbell and Burns canning fact- ory. Congratulations go out to WA Mouse and son in winning quite a by hers were Ernest MacLeod and ets of mixed flowers and the or carried nosegays of multicol- As guest soloist, Mr. Herb Worth), Perfect Love" during the signing wedding. Mrs. Larsen chose a dress of navy Miss Doris Chambe lain sister of. Mr. and Mrs. Chamberlain will cascade of better time roses. Miu Bernadette Burge cousin of the bride was her only attendant. She wore a ballerina length gown of pink nvlon net over taffeta with Her accessories were' pink. she carried a noseg , of pink and white sweet peas. i The groom was supported by hia brother. Alban Wood. The ushers were Mr. Michael . Mr. Chester McDonald, brother-in. Bursa. Cousin of the bride. and . law of the groom. The organist was Mrs. Thomas Ledwell. The guest soloist was - Mr. Eugene Rossiter. c A reception was held at me - Queen Hotel. The toast to the bride was proposed by Rev. Fr. Gallant and responded to by the groom. The happy couple left on a mot- or trip through the Marltimes. For travelling the bride wore an aqua linen suit with white acces- sories. Her corsage was pink tiou oi the Quebec North Shore and Labrador Railway while on loan from Canadian National Rail- ways. retired from the CM! Fri- day after 47 years in railway con- struction work. Mitii.'MacNeil be gun his career with the old Na- tional Trcns-continental Railway in 1909. after he had left school in his native Nova Scotia. The road then was pushing through Northern Quebec and Ontaio. nouseoross IV was wimreu Handsome Housedress Easy to come upon are house- dresses such as this one. pretty enough to wear at the beach or for either working or lounging at V neck and the short eap sleeves. and for extra orna- mentation. coarse white cotton lace insertion with a novelty cot- ton fringe border forms a panel effect on the skirt. number of prizes at the Albartou Exhibition. Also to Mrs. Robert Moses. A.V PEMBROKE. Oat. (CF) - ltt. Rev. William P. It-eon. Roman Catholic vicar-sanaral of the din- eesa 1 Pnnbroha. died is how- piial Friday following a lengthy mean. A native of Douglas. Ont. lie was 74. ' I'I'OPl'COI.D ELVIS PRESLEY Vaunnmltavadisnvh E E of-ii. I 25; la 1 3 i 1?; 1': :7. bouffant non and fitted bodice. '1' 2; go i 3.35.: E in -is 5;? in Onta Mr. W P.E.I. a Lowther, ther. is and the - 3 iii; -ll. ill 51:? 53! gfiig .5 is South Windsor. Ontario. . Earl heard. expect to visit weds. They left on September tat. vacationing at the home of parents. Wright. Central Bedeque. Among the many visitors to honeymoon with relatives friends in Borden. Carleton, Fern- wood and Cavendish. Mrs. Low- Webb. daughter of Mr. Keith Webb Webb. while Mr. Lowther is a son of Mr. Oswald Lowther. of Caric- it as: - is Eal?-:-l. 2::t”l:.ia-i..il-I to Ottawa. . and rto, with relatives next g Wright. Toronto. is ,, his A Mr. and Mrs. Edison re Mr. and Mrs. Harry . who are spending their and the former. Miss Louise late Margaret Lowther I! to visit them whenever th Call Underwood For young couple in their home. "Harry" vary mung. replied and invited on and all inane out IN cuss NIOOSIA. Cyrus British airrnsn.were killed and 3 others were iniured Friday mm when an RAF truck bit a culven and overturned 10 miles east at Nicosia. l AP-Three fil.lDlN(7 - lllillrilllig. MMHINFS latutist MACHINES C A R BON PA PE R Ribbon: and Supplies Ilqderwood limited 1 ton. . On Saturday evening. 18th.. about seventy of their well- Call 3-6028 wishers. gathered at the home of HALIFAX. N. S. the bride's uncle and aunt. Mr. . lfl Hollis street, - 83' came .- Iiyloo with all-elastic bedt. edlusts ltsaiftaavai-ysteva...glvasyas satin-eluplifi...parfaetfit.Weehas and dries qulehiy. needs an inning. Iandaau and tenelina styles- 8AlONOOlIDtlsilvnsashtrlme uuntuoeiaeuuuycpiu-on .fveat.Vaoett.wdk.haod-in cantnliadasmfertwldavangaafstyias. 1 lastrferlavaasin. Iulsbeaslfdaavr sub-uhoCC-U5 hasaieiarasesuyaien. .souttttaiI urn. iii sepsis: cot uh.