- mo?" she said ps l; IRI- Is . * ' ‘flilnion QtqVIIIoOIVIsB-O, » iqnflgrod withall the symptoms nmsioTroublisVnitiWh¥ ~ ‘elmiti-r: ‘r111. body. .1. um YQIIOU “digs without rsihl,_aqdklh‘onpui' ‘ nnderadoctofs-voass and he vpadmeto have I wad- ‘ a . ‘ 1 some tailing ‘halt-o ‘mt; and from the outset, I lei! “imandihlstnedkhsslassnaaplsfly Judaic of slimy misery‘ and ‘salt-l "r for!" y" WI! "i. 3M5»... lfijfllddi‘ l’ ufiwafpfl-II and , seasdtha fln-ihle Constipation; and whstaayod _ when Iffoundit . ‘ set a typewriter, hunt siysnu?" .011 Jitue. ».~ o the cities!“ ‘or. rumour" lex- beavyload. .. .-‘ _ . -_ "You shouldn't have harried it down, Zens. .Wby.dido't yon call o e s, NI ar writer ll the t bi b Mt ‘Ila: as I-'did so, .'.=-’ " x "I'm "all rllhtl l.,wss so esoitod What-cold ‘you ~ "Aj young ntiul hdardedlwitb me a long time ago. He. left it,‘ and never sent for it. Intact. I ..never heard from. him. otter he left" "How long also was that Susan!" Mother asked. . - “About tour, years." _ "Then I may use it'd’ I exclaim- ed’ "Certainly! Use it all you want to. I am sure the [young man would not object.‘ ' {believe some- thing must have happened lb him. He ‘was a-writor-h story writer——‘ and used thelllochine all daylong some days. v _iiilll. ido; he was here -\ Ions lllllefifllitleermed rather iond of me. think he would have written me ii’ he-vvartutili aiive"' "Did he owe .you- anything?" Mother asked; while‘. l examined the typewriter.‘ . - ».~.:-Iiunt Susan fl hed._ The dear old BOUi'll\\\flB'll’O2fB0iIl§ to tcll- us shat ihn.moobine.hl.<l been the only thing the young man. left he'l- for a debt of months. But Mother worm ed it out tot her. Jn seemed . llle “Oh. look anilrsussnzJ loans llaimed as I ‘st gsrad undu- my ‘ u t while Iwas witbfthem. ‘AN INTIMATE ‘TALK CHAPTER s1‘ and displayed in store, windows. But linseed until I succeeded In '"l will!‘ Thank you fortbe sug- gestlon." I replied as I followed Mother with the typewriter to the room Aunt Susan had made mine ‘l hind’, never ‘seen a "typewriter, t " r ‘ ' i ..'.....g 5g“. _. _ , COVl‘,l|:_,j0_RI.lT|N@l,. . Li!" ' 999'“ “m” tlsg- t r would tivehie of!!!" to ‘rulng to dnicsgo, and to wqr . A , u it was onlysftst repeated pits advlcqflhat he said r lnisnt try ll- I w,‘ glad to go back for mall! reason . _ be titklns..my~ weekly. salary Mill ' yap going soluiely nothing 1o llalp, sllnoug‘ Mary kept remind: Elng’ ‘me that ‘she. was only D Illll me back her share of the iuvsst- ment.‘ -'P.\all. too. Ireslissd l war .501 stpqpgl,dand_ ttléatbthe iitglbs‘ shag was- not. .1 N no» e- me. I had not told Mother this. l dared not worrriler. But 1km“, _ rsi-pqskipgowlr a bot-stove. ing‘ trays.‘ all that. were be"! mo, sadqould be for. some time - perhaps forever, 1118i] made good headway with my typing.‘ Yet l. wrote very slow ly sndnltsdeptfllly Milli!"- plan was 'to help Mary as muo or l could for srtime. to practice con. sunny. meant an ofllcs wit!"- I had"not._.thflllght .l might" lilo need. to‘ lmow~ stenosrsohy lo It‘ rucll a place.’ Mybook of instruc- tinoscassaprouotly. It 1W1 below!‘ mo._ip.lineneeiy. and. l-now; soflliil write -witil= veigr. tow. mistlitrth- 1.. Wind ‘fell rather sad 8941191111}. sed at. uspqing-lsotbsr. and Illa. _ crled‘iblt€erly.'.=_-lut Mary's Joycto “greeting and ddgrs; I-‘giginfs pleasurt in , return. wen fifnr- to, diallei ‘any lionflicknsss l-_elt. .. _ 1 ‘iii; ‘i-grflf Tfor. sore‘ eyes to see milflaaaiiiilfllss Zena! "j_ Mrs . Jdagin detdl ed. essve ma a resound; h,‘ ‘jg, ~‘Mn,ry Just laughed hnd cried todei. or.” - " "If ypu h d died I would bavr» - possum. t. , ngs. énnpuo with I.\;' looks to viiu. amosiramus a oaar - lfeitlhisdnor lino "t "Tsalu has: boeasucb. e Ywtloer- tul blessing to my wile, that I shall praise it as Ion sol live, recently declared Atbel‘ ,n ‘Titus, a well- known and prosperous firmer. liy; ing st Perry's Point, N. Q. ' "Bill certainly was in a terrible was so bad she didn't ds est any- thing like pork or‘ nsnca as." _aud even oatmeal would sour and cause Ias to form that bloated her up till she was in perfect ago y. fell off in weigibt until a e was to be and became so weak abs could hardly do s thing about the llouse. To malts matters ‘worse rheumatism set in,‘ and “one pain in her arms and Iegawas an swim -1t kept ber awake for hours pt night‘; Bhe tried nearly ‘Yevcry rhillrin the way of medicine; and treatment but never gqt snyigs‘; more than temporary relief ‘up 1 she tried Taulac. e c " _ ""1 i" iliy'_i‘ife I've never been anything to equal the w'sy Tguiac lot rid of all‘ her troubles, .5511.‘ it. has built "her up 3p yhqpe 5581.. "W flll estlljely "different, woman. 9M w: new w anitmpsattssn Mid is never troubled‘ in the least: withsourness or gas. Ellis has Rained all of fifteen poundg. ‘in ciiit‘ ts litni. ; condition before taking “Tanlso. 1 Why, for ten years bar stomach i, Silo “ s mere shadow of what she used ,, oicept o'n a desk inilififih ofllceflliflli ‘ ‘calm. 8 ill. he, said alien} nbe,grew “She didn't know her. The rbeumatsm "has "$18M ‘and herioulrs hsve"so 1's“ proved that her best Manda hard ‘ to mswrbi in the d days. Nowlhs wouldn't t ms. I llavs-cllsheeil-so; levy. w‘ h.» i; p ]II§E’ll1BUllClilil_ V ell . ,1!!!’ . . \-‘_“l pow vv you mean b) at big word,’ u‘t"i'it. be! my new. . _ t that cost me O6 that if he ever wanted - you. ‘he hasn't slow" qsntin .- l'Ii bet a nickel you are ll- va will someone else youalsed to ow. -or-you wouldn't hi". 1'." ayafrom bins". w ». »- 1 gown soxnxne arise-did llove a rence - ‘N-‘nii fig love ltennstli" i ‘Iniapsisd aunties and 11111411?! Iggy; loft toe s momenh ‘MARY ouovse Hen morass , .._¢¢ _l l‘ CHAPTER so. I '5 During the evening Mal‘! P9091“ - rad to my meeting with J ack. Pry"- one, was so sympathetic, so sweet. , m‘: ,1 just laid my heed on h" should ‘r and had a Q0011 cl’?- Th9 Isa tment because of not se- curing a position. coupled with jug uflgjpQcted meeting; and the memories Ivbad evoked. bad made ‘ a rootlets-l ‘told-her. snnvetwd ‘lcomforted me as if l were a child instead of‘ as old as she. I soon felt better. ' ~ ‘ "A little cry don't hurt no one. she said as I wiped myeyes- “Now go to bed.'lle'll most likely go back lo ‘New York tomorrow. and Y0" 11 never _ siaeirhlm .li8lLll1""lllii959 Y0“ send: ftlir- him.“ v. *2 _ "lift fsiaves- do o...“ ~Amay ‘he sure. , _ Marya adviser-and- went .to' bed. But I dldnot. shore her optimism.- t.- "fl " I' "D11Qd'll\:t‘.a8.>l' Nilflwed . - “ ABLT “BAYER” ARE ASPIRIN “‘§“ ,. - . », ll,,- - ‘I bgiestly.‘,r§1trv~‘ -l=s.<v<=unt" ‘plsclilgnsileetjot pspsriiisr the Mrs. sgln bro practically dIflQppgm-gd up m, “Bells like a child tile'whole night through. She can now work . all My Wlthollrsettinz tired- and feels BB Well and strong as ever she did i“ h" m°~ We blllh firmly believe kn Tanlac and want everyone i0 now what a grand medicine it is." Tenlse is sold in Charlottetown by IleddinBma. In Montague by H. J. Mahon, J. P. whim‘ Murray River, I-I. M. Chisholm, North Tiy. on. R. I-I. Cameron & Co" Crapaud_ and H. Coobon, Murray Harbor. Young -lnan-..- sire raid f h w s ~= . - 4,1,0,“ 22 m. V ,_23_wnu|d “wrlia roll. and then I slowly picked out (evermmy m‘, weak.’ ‘and m. words for hall an hour. ' story off, and then it would come l 5,?“ 5°“ ‘Barn’ l “M” l back » _ sh£liil Mlnexclainiedi witildeililht “He Bold one m, mo wh" he w en o er came n to see wont Wm, ma. Bu, M awn.‘ gee‘ “$3 I wasdoing, and to caution me not for tllolll. . . m overdow . - “m, m“, “'28s: ‘gruig: ‘I'll stop now"' I told her, "sud prlnlmt saying M! story wusn.‘ grit? for a book of instruction. ma‘ what they wanted. m“ may ut shall learn to use tire machine would be glad to hear from him avg“ n I do not!“ on“ . “am n would havenbaanvkmder .I believe you will. Ivam vely had they to“ Mm he "ouldnw write, prou of you, Zena. Sometimes “M ma, he had he“ b o“ _ feel s zf I had lost my little. girl; , WI‘. 1 other occupauonyo.’ gofnge i:d',?1'|‘:,‘: Igknow so little of your life since ‘but asJisni nded her she had s » 1- ' "‘ ‘a ‘ rad ‘do ‘a 5o, and run it success- know anytbin! abouzwtiting siur- gang‘?! ‘naaysmggfi: a? $31.11;; a a‘ hm“, may!“ that lea, but tlloseedirorsilld. and I h“ in“ he “Wm . : . ~ “gumédtr, w s think it was wrong to encourage .3“, I have ‘mum, you.__. ‘ . o1 span flair, s," rpm opts to u|,\ ""9 P°°l'~79"°"-"" ' - .. - “ypg | know Dear" you“; m‘: til I lind- position. Then we will I hud listened rather. impatiently [BHWQL "you have Juli,“ me of arrange hbout the money," I said Tile-neat day when Lwenl out l_ _ wore a veil andnarefuily kept away 1mm snvrplace where it was at all likelylnwollld run ‘oor08s‘thc' Bies- < ant Jack Pryor. i walked as little as possible,‘ as l applied at place after lace. Only to be told they were lied or that] was not expert enough. The street cars were sill-p‘ to be sate for mo; men like Jack Pryor did not ride on them as»- a rule. ‘ | r Ae thedays passed and othing more otf- Jack, reetlled freely. . " l . Mal-y. was not with me as much as before I had taken ill. F0.‘ one thing, i onIy-spenfa couple or hours lunch morning with her at ‘the shop. and for another, her ‘evenings ‘were mostly given“\!ll to "hem misery is the splmfl III flgdl|| "Ffuli-I-KVQ"). ' ‘/ ' {of _ K88. Pl- J-IIOQIB- .. was box, 6 for 82.50, Niel ill It sisli dealers or seat. postpaid b| [rites-tires Lillltol‘ i‘ 1B ~.Pl‘0l6SSl0I18.l Cards CHRONIC DIIIAOEI- New at Vlehrll ‘atol- OIIARLWPIIWIWWN. l‘. l., Sutssrlli» lwndsy. Inlay. ‘ ' At Queen Iloltl. SUMNER- IIIJE, P. Iii. L, TIIQICIY, WGI- scsday. Thursday. Ilourw-Frg-Jijla 8 p. I. eat for days, and I heard her cryiny after she ,w_ept,h;>_ bed, njgiirtsJ,‘ “Oh. Mary! You sllni ;‘:l.'l have done that! You worked so ban‘ took‘. _ r ,_ . - “That stri I litres; ti?‘ isntlr Zens. flhmtaltes b a‘?! yplendid. -. ‘Y-‘llutlj- ' I hate ‘to send Iler . llmfilt. “I've ‘v.1 qua ‘J ‘ ‘i‘*".'..”‘i"-“sl“°‘l;'5 '*'i.‘.""7°'-§’ “i wht e o.or a s8 .81! i! my plan to tit myseifvior an office posit on, _Mq‘_ry at first declared she coul no the shop without mo: F C Id qlldl , flesrlgchpynamsrupnckags which mntsins complete 41hr ' ,or'l‘0‘1’ll|:lll‘|l€,“ Earaohe. ‘sad -:!0‘l':l‘9'ill-i°_l1ll- The“ Y9? “e "if?! F?‘ _ i saw fisumalism, Lulllbsgo, Sciatica, Neu- E Aspirin-the genuine Asplrlll~nfi:.'. . ‘ “m” rut. take Aspirin masked with u... scribed by Plwslsm" i" "l" t - h Ham's "Bayer" or you are not takingtean years. Sow mule in ‘Clznddm As irin at all. I. ‘Handy tin Mm “fltrinmll; 1-. Kccept only "Bayer Tablets oficls tosi- but l if" "Mil" ‘"3 Aspirin" Ill an unbroken "lisyeffioiso sell Inn!“ '13?!" Pidikwujf Thea-e ts only one irln--“Bn7"’”“Y°“ "u." E‘! ‘flhflfls-T Aspirin ls the n- stymsrlc trogistercll in Canada) of Boyer Manufacture of Unli- sicscid st -r f r-ailcylicacld. While If is, ‘oil known that Aeoirln f-wi-fl-s gsinutsslsfrc: tonnlslsl [his public nosinlt im lit-HI. the loblt-ts of Beysrfls VARIE-D oxalate-Moss . ensues as‘ f h d I r, 0Q ‘ a "m" 8 only '1 few tlavs when I Pfilllsed "I0 dilcfllr was Pliilil I100.” monthly II ll- _ vane. NOW! l IUIl-i-li-dmos. l ‘ ' Dr. c. c; Archibald‘ to Aunt‘ Susan's story 0f the young story writer. Invented to-try to write myself. not stories. .but,to learn to use the machine. All my desires to be-in some. private ofilce came buck to ma" Ii-ianb wonder I was excited at finding the type. writer. _ your business ‘changes you, hsv made.‘ But cfyour social lite, you intimates I know nothing." when living on the top floorof I l.felt like Iauging and crying I ._.. both. Dear Mother. Social life u nullify; 898mm“ ‘man n i. . ‘ma, cheap lodging house: intimates —l a in‘ res nss to something Mary said r" ‘aboutd vidlbg tllenloney. ." - ' "l- niflldiss Zena is right. Ros- taura jiltisiliess is always. bard busin s, no matter‘ how sucesstul business and ‘the owner dons ' the work... Maryanne, is strong. Tiler. “'85 File Work, the standing and grflnd 119"‘! "W9. Was too much b t mel. I did not give up spur-sly, lglbll ooked sftsp. the buying, the I I es and so on. IAt the some time oolred for an office position. I met with lnsny rebuffs; bu; l llllo Thomas Clancy. She bad become ngage to Thomas and ‘they were" - 6 be married as soon as they had dived enough to funish shame.‘ »I "I shall keep right on workinB m v/belrweare marrled,"‘-Mary-sald '31:‘ 1 could not ‘o’ money from her much longer. Also when =sllettold mewof her engage- ment‘, 1nd“ showed‘ mo‘ her ring. yrill be llflnlpnl tllot.-__':eilcr:,_;.'rpllo_roars. til.’ wiayer Crueags i,‘ “ Jr‘: ‘ . , T739. it so there would be no trouble To my surprise the man to when llt bills, and so forth, and l felt! I spoke—-tlle manager-said “ on .~ taking... would give me a trial. I. report for duty the ext mos ngl‘ met with kl d ‘ . mo... " ‘.'°"" “"4 tmm" “ ‘, e11 you hsv ‘ . perience conic an; §§fs§¢m§§i§§i _ ."“,"‘,‘f‘.. -'°‘ m" FPJW writ-Iced. think “vies-kin the res ‘and coffee g r. one kindly mks psi ‘Mo; ,;,-_ -store.'-I'- H6Khulhelpod' Mar! " m‘ n you "l"! I position of this kind taiuce you ilsvs gone.” _ {ell "first llilffechyoursoif in short. "You" "remember him. Zens," BM- Typelng alone will not. do." been able to redeem I had named I10 as he sills mil and the interest would f wished nt first. I never had hepl paid over $8 at any place I w!“ worked- and trembled, fearing ",1 hgui snirt ‘too much. , j i... Iilurrirtl home with my' 309m news. hiltry and Mrs. Farinfihqlh lfB]0iCt*i1'V\'.lil mo. but-Mrs, Fagin when it-tooy every hour and. every ounce of my strength, ‘co-am ‘lily living. ' a , I explained to her_'thst asidb from Mary and Mrs. Fagin I practically ' knew no one; then ‘corrected my- self and spoke of Mr. Polio. the real‘ estate dgcnt and told llsr ‘or his ‘FA girl never snows-now‘ s malt isi l new‘ had going ‘return out, and I ain't tahin‘ my Jewelry. any Jlcpnces. Tom ' is-all -= to-tbe i100! m" ‘m9- oldrry as far as I know. But Mat »I~ could -s"end Mother nothing at used nosey. ‘No woman-don't know, this time, and could sea no chance tarpon till" she's lived. with him’ and. to keep my promise J41 m-ake ‘ 1a l. I. sort o: have a notion ma was home for her. I often wondered flying," - “ \ ' whnt I should do when my clothes Only -tbe "day before“ the ‘doctor had asked ole many quetlons as to what I diduandrso on. "Hefliad told me that I could not lift trays;- in fact. that I lnnst not lift anything‘. or exert myself in lbattway, for a long time. ' -- v r _ _-~‘. ' "I ‘lloubl iffyou T-lvfllzeveflbe able ~I am ‘going to toll you a secret — she has s beau." t ' "A ‘beajulfil exclanmed. "Yésga nice sortwM-a fallow. l‘ Graduate of N. Y. Pas Gradual- ool lion . - filwd‘ a " o "r - ‘ Gris. g???‘ fir ‘mmluhue-raia: ole a .. - . ll‘ l I0 h ha Ila e Ollills wore on‘ and I had to- replace it J. c. i, ‘operas m, can, nose"_lt‘tio "ration - Riley abusing. ‘onus ' st. olmoslte l> we‘ Bros. leaner-o Gra on “tirel- ls l0 a m. p. Ia " lgsganrdlglzswy Appointment out. .1. GROKEN‘ , VhTIIVIINARY IURGION Ins agninfl.’ ' r had said‘ nothing ofilhis to either Mother orA-untSusau, ‘and had bound the doctor to-silence. But Ilia not closed, _my eyes all night.’ i f It sure he was right, as any exertion brought a sharp pain with It. But Ilaiso knew that I had to earn my own living‘; ~aurl that I must sometime make a iiome for Mother. Aunt Susan _was‘o)der than she. and if anything happen‘ to do the work-yoiibava lssanfdn- kindness to us, and of his appetite for, pancakes. ‘ ‘_ ‘ : ‘ ' "vosiltss film-l Mother asked. . “Very much. but don't go to building any air castles. Mother. I like him because he has been kind to us, and‘ is a gentleman. '\'o_u see, poor girls working in cheap restaurants, or even in a little place of their own don't l meet gentlemen oftenfl,’ , ‘,. '. "But-don't yolibave, any young men 1rie'l'i_p'.' You‘ used to be verv hap ass»,- 1biushi' ly tnrnedto me. "lle -came"1'o tile‘ lion onenigbt to din- ner ‘lusi ‘before-you were taken sick. Hie‘ name is‘ Thomas Clancy." "Op, a_ Frenchman!" "stop your lsldailr-iws an Irish mamllld a good one_.". "I thought all. IHIILWQIB good." “WeIL. most- all are. It's because or; thatyou malice the bod ones. Don't-you rune ber . him. brought our -' Hal s. Something Ilsd dwthe, delivery wagon broke When i'told Mary howirlnd tlisss ‘hell were,_slle sniffrdnnd said; ..I Irnoirtbeikindi They lei you down easy!“ . ‘ . "Anyway ltmskes bile feel bet- el‘ than to be talked to as some of them talked io_:-.le—snapp‘ed me up m if I hrri done something wrong in asking-formalin! Iq“. » ~ - Wvevrilers and ,.‘ was tgslob ythut wrvly animus sass . Two" Ydlllligs a week -l-" attend t ‘I [)1 mum] I Woflmd‘ however-y’ 80f In. sny . all hadmet Mary's Thomas, and he the. ‘sort Mary-‘woultffanoyv l‘ was rather pleasure, and ‘at times lacked judg- ‘ oftteking-Vcare or herself. ' * l ‘Ina ceaseless grildmf worilvworry,‘ sand disappointment . l became de- ‘P pressed‘ and. llnhail mung-although perfectly capable edt had impressed motes‘ afnice. them- straiptltforward young fellow, ‘inst tie for clothing. ‘ ' Ho shoes. one cheap suit, aprons. and serious, but Mary need-‘n few little things bud been the edfihalsnco wheel often. Sheloved extent of my purchases. I had become desperate. I offer o work for little or nothing un- t Pl -til I had proved my worth, only to My" llternow seemed‘ to run along ~bo told there was no place for me. Then one tiny when cverythinglcok- d darkest. I determined to try 'one So far I'had spent very lit- Some lowbesled remarked when Mary left‘ usToov gebher: ' .-..,. "Don't wt your heart on it Miss Zena. You ain't never done ‘ t kind of work, and perhe won't ruit. ‘I'd ‘hate to sss feel too bad if on sn't get al tilcrc.” . But oven dear pratlcal I Fagin could not quel my 10-!" ,, llnppy feeling. I ‘was ht last‘ ed ns an nflicn girl. I wopld_mois good! Imust! < y‘, lzstill ‘con- more place betore I gave up. I i ‘ _ _ unuco to draw iusolsnougll rromlnppllso at the office of a firm tBut lllid I known what w.» the busirlesetolpay bfrsIFagimsnd brokers. They had advertised fore me. I wonder ifl would my car fares. But-it. now belonged‘ that ‘that they wanted a girl im- taken the D1009. doliflhted B.l_ iirlfsryt" I hadtMr. Pope attend rnediately. f0 86' ll. - 1 popular with mo. ys. I can ro- nlember w-Ileo Jao Pryor and Gre- gory tstursr weljolboth attentive, and that Mr. Lawrence from Cali~ fdrnis loo. seemed verynluch taken with you, to say nothing of all the rest of the boys—tho younger ones who used to trail tirtlie‘ house for tea, and bring you hon bone and flowers." ‘ffifiice and residence. ts- Prince some» Prtnccaadj Sydney Bil raisin; _ ‘ ii-‘al A. ~‘mssDONrA_1.D. k ..s....‘.o.. leiiaiiibr, sis,‘ r- "ulonsv~~'ro_~sl.oau ' in»? Bus: Butldlngpnarlottstows down .or acldetIIIngHeo-rbe offered to bring it." -_ t. t ~ . _ "Yes. l.d_o recall hiimnow. Rather a goodlogkiilg felluwuwitb dark hair)“. P _ t - llrlimv,’ hmvr‘ . "lfre ‘gisd for-'you,,lilary—--tf he is spice’ enonglrfor.’ you; Mother will be pleased.‘ use nebriy sad a at be- . t- , I, . .. ._ . _ _ , i "on. Moth" “u... Don.‘ youlknow oausei said I sane-cued to he an tld that I am as far removed froln that $2M‘ °' ‘wfmrna lgidmmf 5:1": sort of thing as if I weredead? I “s; fmm-i 53" ,. . ma ' “ ' was a ‘outterflygirl then" unvnu- ‘v _,, ' - , ' °°‘°“.='Y. I "t" *‘°'"?."-"-‘.TL""" 0...?" ifhid“ .‘1.'.‘.’".‘.§‘2:°-...z~.;1:i at”; yo»; "_‘:{".":;..““d W" .1. a... rlgt,kipdf{.your',kip_d .rs......ss us.a.- n‘ ‘ or ' mlqvou, m cm“ fzmjn is a flue lsuioipglt right, s... on if‘ school. The ‘little. s the“ mg“ melons of-trduble... nit fiscal-d °l illfllooat. ialsriea‘ off“ f girls Wore paid, andtrdetsrisiinpd‘ 1o be- Yonle Pfilficiieisf. in tilfleudllthoilgh I . "mid i would bave_ to commence - . stthebotom._ _ ~_ ‘,y_ ».0ue<-dn I was‘ returning a from tnew¢llip snfladverliselsisntu. The mill-Jud been very unlike‘, th ones "Mhonitll had spoken. I is t de- pressed, insulted bybls ton . more ‘Mil bnwhaphirhsd ‘actual rpm "110 Vilflll-f -.l took |_ will! along . Wiohlsan Aye he» l‘ wsntoddc be alone. i.‘ -. __ - i-q -. . l. hail morn the pisinest, simplest irons I owned, one Motberbad ai- iered lor.,rne,sftei- Lhadssxplained ~ thatwmy clothes ‘were too good for s workinglgirlftoo dressy. Yet she " understood I hlust keep on wearing them. I ‘couldn't afford, new, and ‘ theulaterisis were so goo they ‘ , . had‘ not begun to show use. - I was 7 walking along deep in thought when I beard a vniqe c: t clilmf, , -. " . . {Whysflens Stewart!" And Jack gryliirrlished, up tb-rlie, ‘nl held ut is hand. , . = “Wyhere in the. world di you . dbnie Mm?“ he‘ asked as he.drew -nry- tbsnd within ~ his ‘arm; Hand swhelie have you been the, last ear?"- - ‘ 1 . If " have been here In Chicago," I replied -to his last question. I had hointcnllou of-telling‘ ‘him where l lived. Th‘! exquisite Jack -_Pry_or - would lie‘7lhoelted-_Ic‘olld he-‘see my ~ .. ~ horse-Mrs. Panda's bourd-ing ouse. r “Lewis go soroewllere and slit.‘ - he suggested: I have a thousand t Lquestioni to sell you." i‘ . ‘mun’ m“ m”! " “ml mum" I made no answer, but. sews‘ v stsribd ‘to cross tbs street. till-e gincelieft you that I" have‘, ‘ ' or -' “h 55°“ I . ‘I, .w snlautomoliileiscnldent. a s ondiqlli two thflpeopil dished as m Whit rd l Vi‘ ' on vat! Young v ‘ ‘ ‘ _ , 4, V hsppenedlbroks égwsy from him‘ - . t .. ~ ‘ . " ~ n .- - _ i -- , jjy ' 1 ' . " . - i‘ - _ tlireilgli s'ild'e treat’: ' . ' [M [J Lfsli...) N * ~ < . :_ - _ -. ._ , . wear. It westff-goinft ward ho e. l - _ _ , . ‘vlbifid that! All! » , ‘ " " _\t‘B to escape from hob» .. iflgthonsland- renmoilisfh,» ‘ . t res: f.t e- t o for inst ~rn"_ ting. -I know posliir _ly ma; ’ old have anyiillnstlo it‘ “iilllos-“m” S"? “Pit-l 8W '0 ‘w, ' l Iii I - The contrast <3: niy position then and now eras t es . Then Vwasitlls lgdulgod dsulhtsr j of n'ricll ms sad a-‘sosisty w __ as. '. Now I we s rwomng rm. and ed to ber, Mother would ‘have no home.‘ ‘ “ ‘ t.‘ _ When I found the. typewriter a rush of hope swat over md-I would learn to use it.‘ I" wolld commence that very day, Then when I went back l would take It‘ with me." or hire rue, and help in the- retauraut, until.I was com etenl, then get a position in an o, ce, where I would not be_ on my feet all day or. be obliged to lift anything heavy. "Will you carry it to my room. Mother?" I asked. "l shallldrive you and Aunt Susan wild If I stay here. - I-am going to start right‘ away learning to jisiljitfl“ - H v ,'-'But ‘llotWcan your‘ ‘Youdkoow nothing about it,",, ‘ j. " ...“I’ll pick itioilt at first with ont- illiger. like‘! usedyto ‘pick out. pieces Ollul-he piano whorl was supposed‘ tr be practicing exc/rcln- es," I retorted happily. __ "Why don't you write to the firm that makes them and ask if they haven't some sort of ‘ lnstlllollim aqtb Irave1thenr."' "s ~ _. . _ . book?" practical Aunt Susan‘, asked. ’ 91gb Mum“, gfgnjhiyou going lime», eeilnlisr _ pretty rnsiwl returned: laughing. t‘ I - - = s ‘ ’- ‘ ‘ Pint Ism serious‘, Dear. I= want ‘ ‘ ~ * you to marry, to have a home " "w" T “Don't worry about It, mother. I ‘~ ' llllY-lllld some one willing. to have me,in the distant future." 5 fVAnd you have. met no one-no one for whom you couldcarel" I felt myself-flushing, as thoughts of Kenneth Lawrence rushed over mo, and I realised l .lnisllt _ have ' cared‘ fl- hinb-‘vsry much. . For- tunately Mother was" not looking at‘ me as she asked the question. and I parried, it by saying‘: gum-LIEU. _ ‘ < 1 "K ‘l. 9-493-“395 Lrrisitcs limited Domain". lnrllitf.‘ rive.” rnyoatjafnc, sun - otttis lsmaintstrasi, ; . flours 1G4 a “m.” on’: ‘ ‘ I aruflyour. , , swim-r.‘- rwouidnl be‘ drip . lthis-{mant Iiie .. Ii y" -" him, I-Ie sin’ , ur class. You ~.....‘f.?.'.'$33§“§1.‘i$“§;‘fiIiRiiliF-Ji “or was‘ I altos. ‘so 1t M“ o‘. the can," .. g -. ‘ anythin against Toni either." f'Y0ll.l|li!flD‘.;lllll yolildowtfitsnt $31,?“ °r“‘““d'.M‘-"y" to marry’! Why Zens, e is never so hslilly as she ls; with a home and- husband who-loves hen-and cllii ran too, if silo is so fortunate iiifitld HEN you buy Beaver Flour , _ ~ _ ou obtain flour thatis ideal for , _ all bsKing-purposes-fiour containing the food valuelntl “wondrousriclincss of the world-famed Ontario Winter “and ‘combined with the strength of Western Hard eat. .. 1710c 50 years lflesvcr Flour has been dallytprovln: to HI-ianadian women that it contains the uailtics Y A . make ‘bread, pics, cakes and pastries the are res food Innings e ace 0 Wale '_ rest. lIol-‘I-llrl < I Tlsaygol itrlaadg 19M“! . aaifatchedafi Joisaieacrap-i the ‘Itch h Proviso ti- _.blslsi ‘ . s ‘Billings made with Beaver Flour have that light,‘ . m! texture‘ sod crls y, flaky crusts-sought alter all conscientious, goo cooks. h Ifiayer ‘Pious is the old reliable blooded flour, uaetlfoi his‘ century -.by thousands of Canadian Isousowlvess. ~ _.al others. , Improve your‘ ilakings y ' I ‘ lrsgstlitiil ‘ initiator Ind‘ _, u...‘ ‘I o...» I .-c lilacs, ‘="_ i wwamfi‘; Q's-moi, Ivtl‘ <<_-.-¢r~aww-.~s-