rns cusawu ousiuiuirlr .. vvvvv v Literature v-vvvvwvvv vv ciql ¢nd i 'P€_f§9'!“l '-'.;F“§5i°"£;;f7. h l ~ M i i A l!’ ‘tact Yliur Gllllilflll l kmhmfimmhskkk A4 , Y", r5150 lAKES nun ‘ any’; “Realm AA AsLfiA-k 11... H0 uss WIFE and? 411512 .Ac11v1111;s ! Flu germs are everywhere to-dsy. They reach tho system throilflh the j . Jif With Old Love, on With New, Not so Easy , I wonder if the fir trees tap ‘III ILAYIIOUSE KEY Ibis is the hey to the playhouse Ilnthe woods by the pebbly shore, It's winter now; I wonder if There's snow about the door. Green fingers an the pane lnhsls ‘a little g the steam, by placing s piecs brown paper over thsthinlyouhsvetbe vlnogsrin. ‘Iile the paper down tight and make a. hole in the centre and lei; the child hold its mouth over it for awhile. ‘mis is s. real good idea. lll__l!llllH Woman Testifies How Fruit-a-tives Stopped Chronic Constipation Sullering so badly from severe chronic constipation that she wss always tired and irritable, Mrs. I. H. Laliberte, 7236 Drolet St., Montreal, as it Sounds, Man Whose Girlhood W made sh agreement to live together. Finds -- Daughter as Spoiled by Dot- ing Mother, Should Break Away Before it is too Late Dear Miss Dix-Three years iiso a mature woman of as sud myself l" splglggmilirggfligaiglryvflaifé We have not been together all oi nose and tlirolt. Mothers csn pro- mt their children in s very aim?" Just sprinkle s few drops oi cstss-rhosons on the children's . them breathe the healing wapor of Ontsrrhosone. Cstsrrhosone stops s grippy cold. llsves out the germs of Flu, Ooughs, at last got quick relief. She tells how. in s statement made under oath before a notary so that everyone con besure of its truth. Mrs. Laliberte saysr-“l used to be taken with bad spells of irritability and lassitude. l could not Grippe and Bronchitis. Get 0s- isrrhosone to-dsy; Complete outfit, $1.00, and lasts two months; small- er size 50c at all drugglsts. Isesgullscryandtherocilswet,‘ y And trickle-y with rain? - J I wonder if the flower sprlgged cups And plates sit on their shelf, $1.1 ii my little painted chair thst time, but have trsveld from State to State. I now and mysell‘ in ' love with s wonderful girl and l wish to Rel rld of the other woman, but she is not wi...iig to give me my freedom and threatens me ll I leave her.‘ How can I flee myself of her. 01' naloircnrrrs HELP Use goose grease and turpentine. two tablespoons tor, ntlne to 4 or 5 of goose grease. nib on back and 1s rocking by itself? ' ll . l ' - ll “Ne! meld eat rig t did not sleep we and could do my work only with greatdil- ficulty. This condition was due to chronic constipation from which l suf- fered severe! . Nothing gave rne relief until l tried ruit-a-tives. Soon alter! have I committed such s crime by trave lng with her. although she went oi her own free will and iiccord, that I can never be rid oi her? I feel she was as much to blame as I and viii-ii in fairness to the Sir! I love imd who loves ‘ meg every night, Give cough mix- . ture to loosen cold on chest and lungs. This is a great remedy. I would not be without it. gms coo/rs ‘ GREENS non SPRING I giiod in silks and absinthe and sul- {The green line-up is much more interesting and promising this spring than lthas been for some time. Blight Kelly. green is one of first rank colors, particularly trfiur tones are smart combined with own or black. In knitwear grape- "green and ionkln are the counter- Jparts of these two, with no; too “much yellow in them. Soft reseda g1 greens are present in sportswear ;_‘ nd‘ besides there is the bluish g arlna green. . "l onszsn CHINTL FROCKS “" ‘Schlaparellfs informal dinner jknd oockite/il gowns adopt atrsisht lines in crepe satlns, printed in lsrge open floral pattern in charcoal and pastels on H. paler ground. Ono rlesign of this kind ls called Garden <15! Love. Long surmou- evenlnc hock-i I" developed in glazed ehintz, similarly ‘printed. JVNE " G AWSBOROUGH FOUND IN ENGLAND A "New" Gainsborough lies been Plound in England. lit is valued It mbout £90,000 It was recently on view at the fTutc Gallery for the first time. Art .sxperte did not know until s. short while B8‘) that it existed. For s. century and s. heli I his . been in the possession of one family. it is a painting of the Byam family. a little girl and hel- parente- The owner is Mr. H. C. Horny. °l .0gbourne, Wiltshlm. The existence of the picture W8! discovered when s London restores ' was asked to NPR-i! 1V» R W" painted in i764. and is eight feet Vsquare. ,1 SOMETHING 1o KNOW swollen slaw? liiéiet 3W1; wirlegisr. dip s. cl n . m W" ground the swollen Pl-m- 315° jnrgle s little cf the vinegar or i! child is too small to sarele. let it . ._.___, SCENTS FOR MOODS AND TENSES You must have a. different 50°!" for moods and tenses-shades of ous- gralnmer days! A fresh-sir per- fu. ..un.e morning memoriei srousnv for a sunny afternoon. o "provoking" scent for e midnlghi reception, a. scent of Scottish heather and hrsmren for lrweeds and knitted suits. Certain evening gowns. we are reassured to know. demand s flower scent. Here follows s. description of one French b0 1 Kent's selection oi Deriumesz-“It is delicious and conmelns’. with W0 deliberate differences in character. When you first simple this perfume you delight in B. sequence 0f TIOPGI flavours, lightly sweet and honeyed. Then another aromatic door Opens. and the secret beauty of the per- fume reveals s baffling symphony 0g w-gvsg q; gvcfy scented element in the world-except flowers-of wood. leathers, spices, and evergreen most delicately moi-shelled." BRIGHT ‘PHONE A Mhyfsir woman house designer is using the newest colored hand- micro ‘phones to throw s. spot of colour into dark corners. Chinese red is one of the favorite shades oi the moment. Some oi these new coloured ‘phones are equipped with stainles steel dials to emphasise the vivldlless of the red. There are ‘phones to suit every colour scheme —green, brown. or ivory. Ii’ 01w which is “not in stock" is wanted, tire telephone pedPlfl I”!!! "19 specially. It is certainly a is: cry from the old dsy of telephone covers. when the poor ‘phone was relegated to s. dark corner of the hall. THREE - MINUTE‘ MERINGUI Those of you who have dif- ficulty with meringues will without doc-bi, be interested in a. new and simple way to make them. Your of watery merlngues. mer- Grandmother's Quilt Patterns ingues which fall. and how 10118 "Id at whet temperature to bake them, are all solved in this three-minute meringue. You can be assured of a thick, fluffy meringue, one which will remain as you make it. Best ofsl-l itlsasgoodsndtastyaslt ‘ in the Duchess oi- started usin them l became regular, my headaches and irritation dis- appeared. l have lots of energy now and can doallmy work without any trouble." Fruit-s-tives have helped thousands of men and women as they did Mrs. Laliberte, That's why it is the largest sellin remedy of its kind in Canada." Tr ruit-a-tives for constipation, in igestion, sick headaches and kindred ills and notice how their tonic effects give you more vim and vigor. Co y of Mrs. lnlibertes sworn statement will senr on request. Write Frlsllstives limited, Ottawa, Canada. FRUIT-A-TIVES-Hc and 50c EVERYVIHElIE Th8‘!!! they go willingly does not But whatever you do. clean girl with whom you are in love. them Return to the ‘double boiler and cook two or three minutes longer. Add the butter and mix well. Pour into a baked Die shell. Cover the top with Three-liilnute Meringue. PINK POPULAR. The interest in pinks. now manl- fested in Southern resort clothes, brings up the question of colors to match or contrast. This favor for pink will undoubtedly come through in spring and summer fashions, and ribbons can always be counted on in some form to introduce the note of contrast. Already, raspberry and fuchsia tones are much in evidence to achieve this effect. A resort model seen in One shop is in pink rough crepe with wide belt of rasp- bem-y grosgrain ribbon and large bow at the neckline. A well-known designer in pres- enting a group of fuchsia toned evening frocks, illustrates the lrn- portance of this color. and at the some time shows how effectively wide sesmes are employed this season. They drape softly around the waist and hang in long panels that trail. Deep blue tones contrast beautifully with these raspberry shades. lln speaking of ribbons. the pesrsnce oi bows is sgaln note- worthy. Grosgrain, Roman striped, some dotted patterns and plain satins are all effective in this way. Shirtzwaist frocks pose tiny bows woman who pays and pays and pays. Of course, every man who the bsck of his mind that when somebody who looks better to him, he perhaps, s little consolation money, and a new love He thinks it will b would marry the woman. For soy w s greater asset than s mistress you standing any good at the bank or But when s. man comes to put h finds it ls much easier to get into a. and that when he gets ready to leav and will not let him go. Sometimes with the desperation of one who has world and who feels that if ls a gold-digger who ls Sothemmwhois himsellofherthanhe as Mr. James Branch Oabell points Oi wit... in these sophisticated tily when she and her partner come seldom does, and then it is up to the cursion. which serves him night ,of U I down the bodice instead u! the more usual buttons-this is s re- treotment. 8mm? moment since I was born ii she could company that I go nearly crazy. She the time and gets furious if I go out NEGRO MAMMY EXPLAINS VIRTUES OF HERBS Old hlerbl. which self-styled "dog. Byut your problem is a vlvld lllustr tlon oi only too often, and that ls that in an illicit love sflair it is not alone the enough his part of the debt ba-nkrupts elltmilfitoslili-lsonhdsthefibililllltin begets that is gone, all will be gone. housing on with both hands to a good thing. But in any event she is considering only her own welfare, and she has no fool. lsh altruistic ideas about sacrificing herself for the man's happiness and ncshsnieinholdlngsman againsthis . wearyoihlsmistressfindsltsvenhsrdsrtol-id doesoiswlfeotwhomheistired. Mosts-uy men with a little ingenuity can maneuver his wife into setting a. divorce OOUIJB. e e e place because she does not want to leave mo me somethlnB should be done. But what? M .0.“ Better consult s lawyer and let him settle Ath your ex-sweetle for you the best he can. iraveling around with lady loves adds up to an expensive pleasure trip, and the fact that sflect the crime nor the penalties therefor. The Mann Act is the nnal gesture of chivalry that still clings to the unfound- ed berliei that no women would do wrong unless some villain enticed her into t. up the whole mess before you marry the You haven't any right to drug her into it and humiliate her by making her hosi- pest if they are publicized by s jealous woman seeking revenge. sli the episodes of her husband's a truth that men ignore The man also has to pay. and often him in heart and soul to settle it. tired of the woman, or it he sees will kiss and ride away. A few tears and it's helgh-ho for fresh adventures e as easy as that. Otherwise, he hot you will, a settled homrls more comfortable than s precarious love nest. A wife whom you are proud of is ere ashamed of, sud it does no man's withhlsflrmtobesDon-lusn. is amorous theories into practice he love affair than it is to get lut of it. e his light-o'-love she bars the door she loves him and she cinigs to him only one source oi happiness in the Sometimes she will. out in his entertaining book about Eve, but the lady love occupies a strategic position from which it is hard to oust her without scandal and paying through the hose. days in whlc hevery woolen of 24 has s i-osd map oi the primrose path, mdlmows what she is about when she elects to walk it, she should be a good enough sport to say good-by pret- to the parting of the ways. But she man to pay for his part oi the ex- DOROTHY DIX. Dear Dorothy D1X—What is-to be dons when a. mother is go wrapped up in her daughter that she cannot bear for the I am 30 years old and my mother has girl to be out oi her never left me alone one help it, and I get so fed up with he: wants me right at her heels all of alone, She will not go out to any st home alone. She expects CORNER ENGLISH PLUM PUDlJNG ‘Kl lb. stole bread cruull. i cup scolded milk ‘A lb. sugar 4 $885 l6 lb. seeded raisins, cut in pieces hid floured . l6. lb. seedless raisins Here is another proof that the needs oi matrons are being consid- ered Just as much as their slimmer sisters. . ‘ Very simple is this smart model patterned for today, yet einceedini- i6. lb. finely chopped figs Z ozs. finely cut cltron ‘.6 lb. suet ‘A. cup curl-ant jelly or grape Juice ‘b grated nutmeg 96 teaspoon 1-8 teaspoon clove 1-3 teaspoon macs 1% teaspoons sslt Soak bread crumbs in milk, let stand until cool, odd sugar, beaten ess yolks. whine. flu Ind cl chop suet and work with hands un creamy; combine mixtures, then add current Jeilyor grape Juice, nut- meg, cinnamon, clove. mace. salt and egg whites beaten still. Fill but- tered molds 2-3 full and steam ll hours. Iiyoilwsntalessrlchdessertior your holiday dinner, a raisin bran pudding will preserve the spirit oi the tradition with much less sub- stance. Although fluffy and delicate in flavor, the rich golden brown is right for holiday trimmings. RUBIN-PUDDING CAKE l cup whole seedless raisins ‘A cup butter or shortening 0n i cup sugar ‘i6 cup milk l ease l cup flour 1 cup finely rolled graham-crack- er crumbs 2% teaspons baking powder it teaspoon salt 1 teaspoon vanilla Add wsll-bsstsn eggs, milk and cracker crumbs. Sift together flour, baking powder and They never set their children them have any companions of rid of even for a. minute. ly well balanced and slimmtns. ‘The material is a new roush crepe silk print in navy and white that suggests s monotone. The ot- trsctive rolled collsr and vest are of willie roush crepe. White visited expo frilling adds s pretty sleeve t m. Of course, you can choose. other materials, if you will. lightweight woolens, for instance, are most suit- able for such a style. Style No. '10s is dsslsned for lass as, as, 4o, 42, 44, 40 and lib-inches Sine 88 requires 3% ylrds of 30- inch material with ‘ll yard of 39- inch contrasting. Price of PATIERN lo cents Ii stamps or coin (coin is preferred). Wrsp coin carefully. _ _____._________...__ “us... . . . . . . . u... . . . . nsssssi'ssll “Sh! Street Address tut-w.» “s... . . . . must-u... salt, and add. Mix in vanilla, walnuts and raisins. Comi/bne well. Bake in two greased and floured layer cabs pens in s moderate oven, 875 degrees l". When baked, cool and put to- gether with s cream filling snd cov- er with boiled icing. it too much of their society; Yet you see women continually doing this, free oi their apron strings. their own ese- They read with them, tslk with them, play with them, take them plncss, They women of the sea. around their children's necks that they can never get never let make themselves old ‘l: never hes-r a woman boast that she 1g her daughter's best friend ms (drum or that she is her boy's psi without shudde ‘ . fm‘ well I know how AMomingifinile aluminum r-llnieu ui- z < usewife was supsrlsitcmfiis the deleting of heshllebaslds lib- to be my only psi and my heart Just yearns I am only allowed to have s date a week, and that provided I get home by ll oclock. Then I have to spend- the following two hours listening to my mother bell how lonely she was ‘without me and how selfish I sin to leave her alone. I have never had any normal girlhood. Is there any- Xvr friends 0! my own esc- bored the poor girl and boy are with Mother; how they long to be rid of mm her; what a skeleton she is at all their feasts. For the young and the "Quqgul. 3,449.5» d“ “yd m n old cannot possibly be congenial. They don't think the some thoughts, ma“ “Mind h" yo“ Mame m. they don't want to do the same things, they don't enjoy the some smuse- some o, “mm so b”, ,0 ments. Each wants companionship of its own generation. If you doubt Georg, m, “m, you new. ' looks. Three-Minnie Medllglo 3 egg smiles, llilbeGtB-n 1-2 cup sugar ‘ Pinch of salt tors” of slave days sold "for whetalls you." are being exhibited at Fred- er-iclrsburg. Va, home or! George Washington's sister, Betty. X11311‘! STAB Old out pieces and set together ss Indicated on small blodc. lithe: print or plain material may be used. Set pieced and plain blocks to- gether in suggested on quilt diag- ram. Finish edge of quilt with 6 inch border. Allow for sll seams when with: pattern. Block finishes 1a inches square 1B plain blocks 24 plwcd blocks d inch binding for border Material required .2 yards materiel for plsin blocks ~i--1 2-3 yards blue material 2-3 yard yellow material 3y, yards light rose material 2-3 ysnl white material .1“ 15rd; 6 inch binding Ioljbol- ssr around quilt When order-in! Ii" Numb" 45* lend 15c for s book of cum lie-t- torns containing ‘I beaut us Grand- mother quilt designs -- every Dil- tsrn different. 2 tablespoons water vanilla or aknofid egg whites. sugar, salt end w-oter in the upper pert oi I double boiler. Beat with a. rotary evo beater until thoroughly mixed. Place over rapidly boiling water. best constantly with the rotary hostel‘. slid cook three minutes, or ‘lmhil bhs mixture will stand in peaM. Remove from the fire and odd flavoring. Beat well. spread R ls not necessary to brown this msriigue. but it does add to its attractiveness to put it in s not oven or Hilde!‘ lfhe broiler flame for s very short time until it is delicately browned. " over the top of pie. This meringue may be used on any pie culling ios‘ s meringue, but on unusually good pie is a but‘ h meringue pie. Bitter-scotch Merlnllle Pie l cup WW" Wear d tablespoons flour 2 taiblespcons butter Mix the brown sugfl-i‘. Q0111‘. and sslt together. Add a. little of the mil gradually and mix to s smooth consistency. Add the remaining '“'"-'. end cock over hot water for sbcutloorsominutcswuntilthe ly. Best the egg yolks slightly arid pour the mixture Erfldually over [mixture is thick, stirring constant- Your Nervous Habits Annoying to Others 7- i l wl h ti. fingers .£|-:h,onp‘syll\g on.the bridge table, hon all, biting the finger nails l qnno to ehzmd he firming to you. our nerves are st high habits o! are wasting In and nerve force whlzlmould o nus the snschln d» ind is cry the y. lgestlcn, the headaches and so,“ mmmwlisi cs5 of present ds in. the of exhausted nerves y the nerve force ’ Dr. Chen's Nerve Food. store's wsy of restoring other: on, irrltsblllt he svslls l0 ln the body The collection of roots and "Siam" we» presented to the xen- more Association and includes in- structions for vhe specific use of etch remedy. A Negro “mommy” has been em- Dloyod to preside over the collection. Her duty is to tell the public how esch or the remedies will act. and how they have helped memebrs of hei- race in the post. Efil you just take one of dose tings for whatever ails you,” ‘M"rnmy" claims, "it won't all you no mo’ and doctors ain't gwine have no chariot at all." White Python By Mark Channlng, Author of u-Kh‘ cob";- thing I can do about it? Answer: There is no resson why your rotio womsns mother complex. save yourself is to leave home. to do housework. Do anything The chance to meat new people and malice Yousteiustlikssblrdlns prison soon you will set warped in on‘ your mind and character, It is a strange thing that moths thing that they a harsh voice spoke to them out of the darkness. “What do you with the woman who is m be mine?" sold the harsh resonant tones of the unseen speak- er. "I sold thst your turn to die should come. It is st hand!" "It is the voice of Ohorjiefi. lord!" wh' Gynis. Grey's heart began to thump. At last the Lame Devll was within his reach! With an effort he collected his reeling sen: I: and sst up. l-le must not impcrll L-rs, I-Ic decided to plsy for time. "Who are you?" hosrsely. "Ii you be really Ohorjlefi," grit- ted Gray, impatiently disentsngling himself from Brain's embrsce, "let us meet fees to face! We shsll then see whose turn to die is nearest! Show yourself i" "Yams, the King of Hell. may see CHAPTER. I THE VOICE 0F (YI-IORJIEFT With an indescribobls suppleness, Gynio stepped dawn from the couch of skins. rushing the nea.::t pair oi’ dancers from her, she bade them begone. They fled like startled deer. "Now I will dance. my love for thee. Lord." said Gynis, in low vibrant tones; and the flame in her eyes licked at Gray's bra-in ss a fire licks st tinder. The bodily suppleness which ren- he demanded dered possibfe the extraordinary un- dulating movements in which her dance b ‘ its t" " fins-is, was a “velstion to him. Whet he wag” “m” st. wss nohtithsgence of ‘ “ “m” '- “IY-R h hedossn love her?" was s perfect human body taking on ‘vi-mic mngnrqny, hm“; m, you before I do!" retorted the " question: love for him, the appearance oi s. snake. A u" ython. . At lsst the dance was mished. "Inglis sim" "Did m4?" you pitted Guy. "m7- fiee of the entsng- ccld my irr- h&aysossm cage now. and unless disposition and have the prison pollor 'i..'..'.""' nsdvestsnfls dlstrac. measures use tom Dr. Wood's Noclrlvyvsy Page A SUP DAUGHTER. whole life should be sacrificed to s neu- only possible way in which you can Get a job in another city even if you have. that will take you away from home, sway from your mother's crushing monopoly of you and that win give you s fresh social ccntscts. you get out of rs so seldom realize that theiworst can possibly do to a child is to monopolize it and to give ling skins and rising to his feet. "Call for lights!" he said fiercely to Gynia. Once more came that harsh. mocking laugh. "It were better for thee that thou shouldst love me, Gynia, consort of the serpent, rather than this dis- hononerd spy! For he is that, and no lama! I will prove my worthi- ness. I will give thee to him if he will swear, here and now, that he will wed thee!" ' Grey felt the warmth of Gynisk body against his lknees in the dsrlr- ness. "O thou who are to b; a greater god than the Whiis Python", she whispered, "swear it-thst we may be free to love for ever!" "I will not!" he ssid, letting his teeth. "End this shittering of bots in s turmoil Let lamps be brought! . . Gynls," he went on, in despairing appeal, "you know what love is- nome better! I love this girl who ll your prisoner! Set her free! . . . l don't one wh d upon him. “List us have light, I say," he diolited. Gynia struck her palms together. Immediately scared-looking st- tendsnts, lsnip besrers and bode- iully grim guards, poured into the cavern. No me uttered s sound. Gray glared round him like s Your Syslss dossns of measles Bum“, sls psinhssd s a so a losd to serious-locum. any rsry. ~Ilor relief his Syrup. Its llsslis strsto sad slowly sou throng relieving oppression rsi- his ~ sndiiglitsess. lholmsrywllsrs. “summit-canton. p a STRIKES...» rzoor cots COUGHS confined much more than they ever love our happiness than we are to theirs; them than they are in us, and that and not Dcnnlttink her to have o'clock, that is rank tyranny and for her to stake a rebellion and trapped tiger. The gusrds had on- circled him and were waiting for an order from Gynia. There was no sign of Chorjieii. The gallery, from which he had thought the voice had come, was empty. "Bind him!" she ccmni . "the first one of you devil's spawn who lays s hand on me, dies with his back broken!" snarled Gray, bsr- ing his huge arms. Then Gyriis spoke again. "One movement of thy big body. thou fool. and thy Inglis girl dies» and st once-s death that would put iesr into even thy heart!" The thought of Piers being tor- tux-ed, or leit without even the tor- rifyingly TSIIIOlig chance of his being able to aid her, caused him to sllow his arms to bs pinionsd. Ilesr, snger, struggling for mastery in him-fear for Piers Bryon, anger against Uhcriieii, and disgust st his own fir‘ impotence in this woman's They were about to lead him siwly. when Gy-nis stopped them. “Listen, thou lying lnsulter oi man-y women," she exclaimed. "I will send thee to what msy still be left cf this Inglis girl, that ye may mske the death that ls shortly corn- _. 1 his to ye the lisrdsr for each other!" Oniv Gynie knew inst those Tbs [wills-like hssd slaw stood before her ‘Did the hinolibesk why . ‘y h. desires to see mo!" asked Gynis, looking lsnguidly into s Ibldsn mirror. The smsll, reddsned eyes of the slsve become even more watchful. "He said, only, thst whst he had to tell was for thy esrs alone, mis- tress." answered the women, her ape-like lips working in and out. Glynis pondered. Bhs knew how deep in his ‘ s confidence the hunohbsck was. Possibly he hsii infoniistioo to this, watch the perfunctory play oi children when their parents are 1t is dull, pepless, quiet. But let these some and there are howls of laughter and sores... of excitement and joy is im- snd disguestwerel! hn-hends issrostoriisrw. hsciflvmsswst Ollfllllsl und. children be off by themselves Mothers should have enough sense to know that we love our children us; that they are much more necessary tn {that 0:11; are much 12101;“ interested in e way we con d their love is not to make tco great demands upon it. As for s woman not glvirgz her daughter of 30 any persons! I dates and requiring her to be in st ll the girl is si! denisnd , berty ly t0 submit to it. It is time l IIBQdOm. - DGZGPHY DIX. "I will see him." she ssid. Lost in thought, she suddenly felt the hand she had rested on the couch, seized and kissed. She snatched it sway with s sharp exclamation oi anger. "What seebest thou, monstrosity?" rho demanded. “A whipping?" The hurichbaolrk yellow face flushed into orange. “My body may be crooked, lady," he said, his pig-like eyes glittering with suppressed fury, "but the bloat! in my veins is the blood of the great Genghis Khan! Not as one of thy servants, therefore, sm 1, but one sprung from the loins of a king! ‘that which I have to say to thee, consents . . . us, lady!" The hunchbsek gssed st the nude besutytof her and sgsin licked his D8 Gynla regarded him nélchslantly. "Couple us not, even in thy talk! That thysyes look upon me, is in- sult enough!” The belied fury in the Mongol’; eyes wss demcniscsl. Her bssuty and! her contempt were driving him ms . "Lady, I have told thee! Soon- very soon-I shall be s king! Thst will happen. whstover thou msyelt my. for it b wrotteu! 'l‘hen."—he bored yellow teeth dog-wiss-"then I will sley the lumbering travesty o! a marl whom they have brought thee for shusbsnd! . . .Myb0dy y‘ Bridset. who sues in dusting a novel, milled knowingly. "Yes. mains." sh. repled. "and i seeone or twooithsmoughttoro bsoktothslendingliblerysswe!" MoTsvish friend : l wise. , we've got s case o! lsrynigitis in the house." Mdravlsh: "Weel, bring it along, men-we're drinking snytilins ' he!!!" lérsspocdsshissndbybloodbfl- p. Gynla, seeing that rage was lull‘ idly mastering .nim, fostered his anger. It would help the plan she hid thought of. "I discuss not my lovers with oth- er peoplds servants, thou misshslr- en lump," she said contemptuuuslyr "Were I to tell thy words to him of whom thou speakest, he would break thy biggest bones as two. thumb nails crack s. louse! Why thou are come?" "I osme to toll thee . . . of love for thee . ._ . Nov. hear ms! he implored. "It was conceived in the twinkling of an eye! Thy beam)’ burns mo, Oynls, consort of the set’ peat! . . . I, the hundredth son or s King's son, tell thee that l 10W thee! Not s1! thy crafty Milne?" csn hinder " Ho stopped, suddenly realizlnk m‘ danger of what he ir-d snir! boz- s moment Gynis studied thl workings of that le....... .. ,_ . of s hoe. She had known this dfc; lsrstion was coining. She it should come. She knew that no! she held this braggarvs life in tlifl hollow of her ilsrld, and the thwshi pissssd her. Boon. ellfwfflinal“! soon. she would empty her palm! _ "It is flood M he ' "' h" iii!”- sso ssid slowly. "m time "l" (OontinuAsdWon Pm 9) Ti .p- . ~ on"; [if gnu is ideal roi- lie on. senor-Q ‘rj-itmm-gsloasyiltst the sot d