i»? l, .4‘, e~ i» ~ Observemiahielllblllihiplelules‘ iiiriiiiiiil . n“ nfl slvrelsetvlll eelevunlsesaesslflou gglt? .. F fi-Tafi 5 m» ps-sZzué ‘calculi Wallis CANADA'S: fimlma who last one or mm eyes rut: Jeanna was amused as her own pose when she listened to Barstoweb words which meant the fulfillment , of her IND! ambition: "Jeanne I love you! Will you be my wife!" Bhe had'often wondered how she wouldmeet lbecrisisinhercareer; lfshewouldhsvc the staminsto avoid the betrayal of be: exulistlcn. To her surprise, she discovered that, beyond the sense of satisfac- tion which one experiences when 1n the lsst year wsru women. 7 MONTREAL, Que, Nov. za- m Belgium, the paper manufacturing industry has made rapd products including fine and semi- fine paper, wrapping paper. card- board, blcttfing prper, carbonpaper parafflned paper, photographic pa— per, wall paper. etc. The raw ma- terial is largely imported, states the National Resources Depart- ment of the Osnadan National Railways, and Belgian manufactur- crs are turning their attention to Canada owing to delays experienc- ed in deliveries of wood pulp from “ " ---- countries due to the restricted productzon and advan- tageous rate of exchange of the Canadian dollar in Belgium. Bel- gium's main supply of wood pulp has in the past been satisfied by Sweden, Pnlsnd and Norway with limited contributions from Ger- many. the United slam. Canaclis and Czecho-Slovnkla. The demand is for strong sulphite, easy beach- llll Bllliihlte and bleached sulphite Pulp, kraft pulp, poplar pulp and dried and wet mechanical pulp. EF ,T° b. mid‘ N‘ llulllic out-non nll bulurduy the J0lh day ufDccomlmr 11133 at ins hour of i2 ociocl; “Wu, m front of the Law Cour-ls Bilijlllll; in Lhariorteiown all that tract plum-u or Parcel of land situate lying and be lug on Township Number 5:: in Kings Uountyg bounded and assumed H follows. that is m say: Bounded an the north ivy [he Morvll Road; on ,1“; oust by the western boundgry line o; [land now n» formerly in possession i“ Ab"! Flllllysou; on the south by the resr line of forms fronting on u“, 5"" ville! 3°86; su the wwst by ' $ QD ‘i119’ 4E Z POULTR .' l will be buying (Paying Cash) Jlressed Chicken. Fowl, Turkeys, Jieeae, Ducks, pnying top market prices, at the following points: Tuesday. December 5th, scuria (J. J. Hughes 00., Ltd.) Wednesday. Decmbe cut/dear Point. Thursday, December 1th, Kings- horc. (Mrs. Walter Robertson.) ~ - - - ~ 93L Flwnlrl and North 'Lake. HARDING IRASIIR, sass. The regular quarterly meeting of the Fish and Game Association will be held in the Board of Trade Rooms on Friday, December 1st at 8.00 P. M. J. M. MacFADYEN. Secretary 3968 The Eye-Sight 0f A Child ‘ from her chin, but m still stood bc- ones carefully-laid plans have suc- ceeded, she felt no thrill. Perhaps it was becauseshehadhecnsosureof success, whether it was Barstowe or any other man, she thought. Or per- naps the realisation of an overmas- ‘toting ambition is tame in contrast with the scheming and plotting and arduous play of the game itself. Bsrswwe had dropped his hand side her chair, quietly awaiting his answer. She liked his rcscrvc. She bad ai- ways dreaded the possibility 0i I maudlln display of sentiment or emotion in the man she picked for her purely business-like scheme. But, though he waited quietly, res- pectfully, for the word which would accept all he had to odor or send him away forever, she knew by the tense attitude, the controlled breathing mat hc was not unmoved. looking down ill llcr slim hands, folded in her lap, she said hesit- antly: ‘"1 can surely he pardoned, if I ssy that tnls is—suduen.“ l-Ie made a negative gesture. "Not to me! l knew l was going to love you the first minute I sew you at Csnhyfis dinner. Tns marvel is that 1 didn't tell you before. I am amazed at my own restraint. Jeanne smiled slightly. “Do you know WHY you—care-- for use?" "Hardly," he replied. "Can anyoneI analyze love? It exists or it doesn't, and not even the greatest seer on earthcanwlluswhy...0hl could say, cf course. that is because l 11M running from the llorell Rogd to the ssld rear line parallel to the ssld western boundary lips g: “m, Flnl-lrwn- lane u a sufficient an tsnce west therefrom to "pm-q" n; ares in the lsnd herein described of H’; acres, Also lli that other tract, piece sml parcel of land situate lying ",1 “m; on Township Number " aforesaid bounded and described ss follows that l‘ ‘° "I1 “flmmvnriil: on the north sllle of the Morel lloud st the south. Weslvru curm-n o land sold to Juhn S l‘ra|le_ thence- nnrih at right an». les to snid Mort-ll Road until it Lucile Peskes Road. thence west slang Pesk- gls Bond thirteen chains and seventy. v0 links, thence st n"; "g1" south to Morel] Road and thence east 1km‘ “m M97911 Road fhlfieolu rhulnl and seventy-five links to n". ncv- of_ commencement containing "Will! fm- scrcs of laud ,s lltilc more or less. The shove ssle is m“ M Bowers of sale contained. l‘; s: ""1"" "l vim-true dated the 20th da of November, 1919 made be. tween smes Fisher of Rivclfon and Buthle Fisbcr an w-fu- of the‘ one Dart, and the undersigned of the oth- Pl’ Dirt, default having been made l" Payment c ri i l ' "M moméigt W Da and interest of For further pgrflgulsr McLeod and Bentley, stilenlfihff. n. rbll 30th day of Nuwflmbgr is perhaps the most important of the functions, contributing to its development and educa- tlon. DEFECTIVE EYE-SIGHT h a constant drag on the brightest child, and is very apt to inlure its health. We recently fitted a little girl with glasses, whose rank in clam had avenged about fifteen, and the very nut month she occupied third position, a striking evidence of the benefit of greatly improv- ed vision. At Your Service. B. F. IIIITGIIESOI lottetow Dated lid. EDNA AUGUSTA IICDOIJGALL LIGIULATIVI Alli] PIIICI IDWAI-D ISLAND ii.- lulcslclnlllllloPl-lvllelllls The Coal we sefl h cardully IHMwvswlyueruessssq-sy ulsslyfreslfmsssyklnbofh. lflermsttvmscaueuee. ' lvlrytonweleulouthalhfl) salty lv. ll. suns a co. h 00M. PIONI: l" Professional Carla . Stewart If uowther I Great (ladle disses L . Memoir-s BENTLEY - as. sun-as! you are very beautiful; or because beep Barstowe waitinl until she spoke the word that opened, the gateway to this glittering future! - She smiled inwardly at the irony of it. "Well?" Barstcwe prompted du- ally. Game to play her hand cleverly till the last, she turned around to face him. hsr eyes troubled- "Yotrre quite sure you ought not to think this over longer?" she ques- tioned, “Remcmbe , you dontknow me at all. You've only seen me s few times. i-le smiled lightly. “I think I am the best jtidgl of the state of my heart. I have never had the slightest doubt on that score. The question is: how do you feel about it?" "I don't Jeanne answered slowly with evident bewildament. "l believe I oughteo have time to think it over, don't you?" He bowed. "As you wish. You know of course what I would prefer Oh. Jeanne, can't you love ma?" he broke out suddenly, his splendid control slipping its leash." As he came toward her, Jeanne drew back against the curtains. “Pleasel" she pleaded. "Oh, don't be afraid! I wont touch youl" he said shortly. "But Jeanne, 1 had wanted w take you out to dine with my family this evening. It is the first night they have been alone since I met you, otherwise 1 would have done it before. I phoned my mother at noon that I would likely bring someone out-taking the chance an you, you see. Won't you l come, no matter what you decide to say to me? I have s peach of a fam- ily," he added boyishly. “Maybe when you see Mother and Dad. you'll think better of me." This was disconcerting news to Jeanne. flhs had not emlnlnd m his you are very clever. But I have known beautiful and clever women before, and they left me cold. Per- haps,“ he smiled boyiehly, “perhaps it is because you are different. Though, of course, you arc differ- ent because I love you. So you see, my reasoning progresses in a circle." Jeanne said slowlyl "But l! I sm-diiferent-iroln the women you have known, you would grow tired of that very alien qual- ity. We like diflercnce in our friends, but in a closer relation- shlp—" He broke in impatiently. "Must we discuss the abstract? My love is a very concrete thing. The fact that I want to marry you is definite. You can scarcely blame me if 1 am slightly impatient." "But you must give me time! I must thinki" protested Jeanne. She rose 511d brushed DY him. H: made no effort to stop her, but his eyes followed her as she trailed slowly to the window and stood minim against the frame. lwklns down cn the Avenm traffic. She felt his eyes. She knew they were burning with a brilliance she had never seen before. But she also knew that in her misty white drap- eries against the dark velvet cur- tains, she made a chlflmnl 910W"- Lnwardly ahe was amared at her- self. That sbe dared to keep him waiting; Wealth lay in her grasp-J impetuosfty. Bhe had meant to out him oi‘! today, lust to forge tin chains of her indifference more see- urely about him. and than reluc- tantly,-very reluctantly, - accept him on the morrow. In later days. she never wanted him to A member that she had jumped at his pro- posal. - But introducing the family was a dangerous element! Bbe recalled Adele Parkinson's convert warning about Barstowes mother and her passion for blue-blooded ancestry. Suppose she suspected her pros- pective dsughter-in-lsw. disliked her, ferretcd out her secret? No, Jeanne decided instantly, it would never do to meet narstowei family without having first slipped ths loop over his head. There was no alternative but to accept him in- Het held GIOPDQd akalnst the dark velvet background. in the trail- twilight of me room. she seemed like some elusive phantom creature poised for msbti Bhc lifted lief eyes a little shyly. "I don't thin-k lnythlng could make me like you better than 1 do," she whispered sud rsiscd her lovely eyl to him. There was no mistaking the sig- nificance of her admission. D01‘ Q10 gesture of surrender with which she tched out her hands. ‘ In s single stride he was beside her, and. though she seemed to trallcl It was the last hour of sunlight in, the short winter afternoon-the‘ ggyest hour on the Avenue and iui the Park. The sidewalks were filled, with smartly dressed people. Oount- lealmotcn‘ ‘stormdnrolnt that wound its way slowly down the streetssfarashereyeoouldsce. Across the corner o! the Park, the waning sun shone m stately marble b‘ sdiflceswherethsaftsrnompartles oftheweaitby wen in program. lhscouldseeswninflsuetchingto thesidewaiuandlheilsshofsilk shrink a little, h! IIl-hcred her closely in his arms and held her gently, locking down into her eyes with his brilliant gray ones. “You don't love me now, sweet- heart." he said a H8 hulkib, “but 1 m ping to nabs you love me some day. Bay you'll marry ii . . vlllilflflllllfl/fl Thuruhsui. Kmtfleanticuwctthslhllfll onhbfhsl. Bvershesbareaehedatwo-GI- iuelliflulhesbecufinscrcn archseolcgmlwfle is Bearsicd. wherehchves, beessus used to mlfllhllllwlflflfllmilndhlhl i 3i a iii; i ‘away. ' They lulled a little at his "youthful ‘filly!’ Eli Paul has earned their _, “ end ems:- sticu now. He bawened to notice sane ‘rablit burrows ss he was walking ‘across the farm. and pieces of red earthenware out by the rlfltl- His entbupsqu was aroused “itc- mun tllfl." Old Paul. "Rat's right, they are.” said Norman 000k, cura- tor at Melbourne museum, to whom Paul conveyed his finds. Wild with sleitwnent, Paul went to Charles Brown who rents the land and asked pennlnim to dig. Mr. Brown couldn't refuse ihc ex- cited boy's request. i a § E 5. a i i? g2? i. . ‘i’ r l3 “Paul has never thoulbt of sni- ihlng else.“ his mother ssld. “He is crasy about archaeology. When he was fourteen he went down to 8t. Augustine's museum. terbury. and helped there to get eshbiis readytebesenttethenritimmu- scum." Worked so m Speed Sc, armed with borrowed imple- Heated Dispute Over Roosevelt Monetary Polio (By l- II. Blpp&$er) (Associated Prel Qf-aff Writer) c“. “d” NEW YORK, Nov. n4-uim- . ‘hm “m, l Father Charles I. Cmlghlizrs de- l“; 5.2g ‘mhtwml fem: of Resident Roosevelt's mon- m m‘ ‘mun,’ "had n m. °“'yp°n°“'"'°°h°“ “nkhlmomoefcrmerdoverncs-Qnithssld three ecu-smug developments. z ' 1—A.lfred-E Qnith, whom the “w” m" ‘pH-um _ Canadian-born Priest described yu- ‘h. :5 ‘ mum“ Zwlmdmh terday sftbe "outstanding catho- m a ha“, cont“ mum‘ u “Irefusetncouleintohisdiocne andsfartaduarrellhereuuesr- tain prcprietlesofgentluuanliness and etiquette among ciergymen which forbilb such adiseiueion." . PutherOmlghlin said he had neithqrhlkedwlthbym norvisitedanycffidaleofthedio- i urisleadiugthesn hyfalse state- meniJ-Irpolscnlmuselriudnlent withbanlelfllufir “Prtllbwhoodlwfltallhtthll sfiatlseliefiiestwssundsradlh eesinylmetiontlwtesdfeilnatims’ thawcrdofdodlhatinehidesthe Divine “flioudislt notbearfakewitncialalndthy nelgltcrfl" htberdmithllninsninterview beforeamsssmeetinglastnlgbt has: .“'I‘Wo Oathoiic bishqn mm Smith at his office building. One 0ft-l1€mlld@dIIfl.Y01lW1lllfill' frcmtheotherolte. Qnlth was hIy-Hsstedthemtoccmealsng wltnhmTbeywentinsnsutcmo- hxtotbe oonnerof Wall and- Broad Btmet. Smith wmt inside- to the office orllttl-h. he came outinaboutlbmimmhisfsce wreathedlnsmilmsndgavetbe bishofllioursderstandhehsdre- ceivedalugeloenforbisomqe buildingmsnllorgan." Intelligible Research Inhlsaddnen at the annual conventionofme Canadian l0- . elllydlhmnicalagrieuituristqat lather Ovughlln imimlylfivlnhlrLlhnieliflalltmsehed aim to his audience," QnitMde-‘m some of the dangers baettlng dlltedin asbtflnent, “thatIev-‘lpeoinllltlon. “8pecillintbn," he enspoketcln-JsorgsnoranwodysaIGJisafscticbeXaeedWere- cenneetedwithhlmdwoutthismfllnlsethaencrmmlsposercfthe snyotherfinsnelelfrsrlactmlalvflfilflllhhlswayofpenetruting that "my position on the monetary question was in any way affected b7 IN lOI-n frun J. P. llofllll." S-Ugr. ‘flushes G. Osrmll. chancellor at the Oat-hells Arch- floeess of New Yuk lid the .. .._ m - Qith was Iisoluteiy unwarrant- 0d." s-Before returning to his shrine of the Little Flower, Pit-her Cough- lln said he had furthlt plnm to de- fend the Adnllnlstratlonb money plogrsrnsne, but be would not ad- dress meetiqs in any diocese if the diocesan authorities did not ep- prove. q Statement I-‘slse The former New York Governor -'who decried what he temld ‘baloney dollars" and the " pig" experimentation of the Roosevelt Administration in a re- cent edi as "sbofnteiy fsbe" lather UUQH'_ um stcry tint Qn-ith gave two; Catholic Bisbflfll "to lmdlrstand thathehadreceivedalargeloan‘ for his office building from Ror- ‘m, g-Q You'll like this Powder, too . . . Eva-yous knows what s good cleanser BonAmlCdcsis-buwwellitcleans windows, mirrors, metals, ale. And Boa Ami Powder is equally good. It contains the same serstchless ingredients as the Coke and comes in s lifter-top can. Most women like to use the Powder form ofBonAml forelcsningflselrbstb- Inbs, kitchen slnkqooru and para, lincleurns, painted w eves-here. Boa Am! doesrflt scratch. the may things It cleans so well, doesu’t ronghm our hands-and is odorless; In eitha owder or Cake form, it cleans quickly sndesaily-l-sndpollshesssltcleans. sou AMI . . . cleans thoroughly but doesrftecralch. " "Inn's senesbed You" ‘PENNSLYVANIA BARS NW1‘ TO AIIDW WAITBDSSIA fromrutalnantssndhotelwhid sellllquor. The iteesseselsunlflmorlfl wouldbethrownalstofflflflrmui inthsstateafterrepealdpro hlietcuunder the llopuedut. ‘u; l‘ “lwmcn has paned the house. ‘Egg Production Tests Tests to determine the most eco- nomical ration for the productlol oi’ eggs at the Harper Adams Ilsfi- ' cultural Oollqe, mglsnd. result" in no material sdvantln in W! m, m“ who fish meal intend of meat-am- umhnmdlnom meal, dried buttermilk use“ ‘o: dried skim-nail. or pee-nut moi ‘instead of sofilah meal alums ti" pullst year. In thb year. the bee! bcnemee-Ldried skins-milk. ll" saybean meal. ‘Hie results in thl .'salnelllnthe|lllletyear.iiailrh' acme; was not materially affcclflil hatating whatlsfisolutely false. intothelIWIferis-ilndinllflcult- lhcvenevertalsdwithllnllor-wewearecoucerned with that’ gunonauynblsdwmesmmrrjointmcnnwdeuiousofsllthlnp.1i!e., ssrviceundIcurqpoinunutin-Yctwebsveaeguardsgaiustscme getherbythellsycroftheeityoudthcdanslrstewhichousrre- aeommltteetoaileesiaststenmdssesmhisewosedflrhedsncsrsris- for unmniov-mm relief." H. nerhlnlnomihe intenstcftlse whllctheemtofllfnOlt- simjeut ifllf. Ifyou gunman loll didnotmeeqsIsuchapos-lwuklng nth-lately, Jeanne raised her mouth in an» wenhereyesclming. lhewassufflflndtciiudhlslllfi cubersadistinewvlvllwlblvlfl" tTo Be Ocutmued.) FQQIDWQ. Assuring, plying between the can-by the various rations. rbr bird!» ‘llllh sud Acoeriean aault, mum, two years, ltwasfoundtiui m, nsar1y_overy mm, sitting in a mixed protein ratim we b" sccrnsroftheferrmtbepam-a terruultstbsnaslmpie WW“ sown-ills. When uie-rsuosmwoammseenwilcre- ferry mine lu nu. mp u» the lturns, musty and hakhabllll! Midugm coo. the young msnfrhebumweresingleernrbwhl" has l ‘lea Isay heals visas-aces mernms. we 011"- gan, how is tats-let this moraine? firs. ullllgglb—llll'fl, ‘e1 no Rim» VieabWby dseftycrlsend him" hcflflaitobatrsahd! ammo-mummy“ ‘PaMLitbflsbrlerlm trin- aialrcsly-ifl J55 ie§giiiiig§ E5; __< FQ.