PAGE TWO oman’s Re a ll . E‘ Dorothy Dix Says- WAR MAY INDUCE WOMEN TO WEAR DRESSES AGAIN Draftees Say They Are Much In Favor Of Girls In Ruffled Frocks Ono of the problems of human behavior which is ever good for s hot argument is whether women dress to attract men, or make other women envious. Personally, I have always belonged to the feminine school of thought in the controversy, for it has seemed obvious to rrie that no member of the fair sex could be so ignorant of the tastes and habits of men as to believe that there was anything about a do-funny hat that would make one get up and follow it. or that they would be intrigued by the sight of high-water skirts or shorts that disclosed their wearer's every anatomical blunder to the public gaze, them look like figures o fun on altruistic grounds. You might say that they desire to be amusing and to give men a good laugh in a world that is overfull of depression. but this theory falls flat because men have no sense of humor where women are concerned. No man would step out with a living caricature, and while one might stick to a girl friend, even if her char- acter was aspersed. he would fade out of the pic- ture the first time someone snickcred at her ap- pearance. Of course, you might account for women wearing fashions that make If further proof were needed that women pay scant attention to the tastes of men in selecting their clothes. we could adduce the testimony of thousands of husbands whose wives d0 not even make a pietense of trying to please them in the choice of their wardrobes Mrs. Smith makes no attempt to hold her husband's affections by - l ' means of wearing the pinks and blues he ad- IIlIlPB» Indeed. Only after married men learn by experience that if they crllivlye their wives’ hats and gowns they will have to buy them new ones do they become wise enough to suppress their opinions about them. Women are so keen to please men in all other ways that it render; _-- inexplicable their indifference to men's opinion about how they dress. as THE RUNE 0F HOSPITALITY M8101‘ is vxoiilplificd. for instance, in their etti th l lik imi men. All nature ls against this. g n8 Mme ves up e “Mon To begin with, women are built with a. beet-like figure that is not lKl-"lllcd to the wearing of pants. Then. when they cast away the gar- ments that flatter them. they throw into the discard their own best bet Even a homely woman looks pretty in a pretty gown, but it takes Miss America. l‘l(‘!‘5L£'ll. to pct by in slacks. And, most important of all the thing that attracts a man to a. woman is the attraction o!’ opposites.‘ He wants a woman to be different from him, not his understudy. Women understand this feeling in themselves. aglne herself feeling anything except repulsion for a man who Went about dressed in a decollete satin evening gown and covered with jewels and gewgzuvs. But she expects him to like her in brooches. ‘This feminine yearning for masculine habiliments has had some in- teresting. and perhaps revolutionary. side-lights thrown upon it in the present war. According to the statistics gathered on the subiect. the response of women to the call for volunteers for war work has denmded largely upon whether a uniform went win, n,” for; vf then- was a cliilncc at brass buttons and nerchance a Sam Brown belt. they flocked t their countrys defense. If not, they were not so hot about it, ‘But. on the other hand. the draftees with almost one voice have crir but-I "Send us Hills in mffled hock-s for our Parties. We are sick o’ looking at uniforms." ‘Now one of the most famous designers of women's clothes in 0H» toilntrv has announced that she is concoctipv the most feminine styl=s sho win think of and making nothing but frills and furb-ilous for fhn duration. because that is the kind of clothes that men want to see women u-mrinir. Thar is what men like, and the way a man wants to remem- ber the girl he left behind him, So maybe. after all. one of the reformation: ‘hat the war is vain! to brine. about is to get women back into dresses. They are so much easier Oi". Gill‘ QYES. B" a ‘v USE ODDS AND END! OI‘ Flbfi FOB THESE MOTIFS No woman can im- DESIGN N0. 512 rhose designs are easy to embroider on children's clothing. curtains, ib covvrs. cic., they are adorable pictures to frame- In a very short. imc a room could be quite colorful, using the odds and ends of floss in the scrap basket. Hot iron transfer pattern No. 513 contains 2i motifs gensuring from 2 by 2 to 4% by 6% inches each with complete instruc- ons. To order pattem: Write, or send above picture with your name and address with l5 cents in coin or stamps to Needlework Bureau, Charlotte- town Guardian, To Charlottetown Guardian, Needlework Department. Design m». 518 NAME _ _ _ _ _ _ _ __.....___.______-_—- eraser Aoonnss----------————-——— crry _ _ _ _ _ _ _ —-—--PRDV1INCE--—-—--——— WILLIE THE TOILER POO. § Rich "KING COLE" is n fitting accompaniment \ to your own good cooking. and regular grinds. m "f. Social and THE CHARUYFTETUWN GUARDIAN If you could put coffee beans in your own oven and bring them to the same state of golden per- fection as your home-baked apple pie, you'd have no need of “KING COLE" COFFEE. . . But since you can't roast your own coffee. "KING COLE" COFFEE, roasted right h¢f¢ in the Maritimea, provides you with the best cup of coffee it is possible to make—FRESI-l and full of flavor. "KING COLE"COFFEE. \ the natural choice of “KING COLE" Ten users. is vacuum-packed and rushed direct to YOUR grocer. Fine \ . s Personal I Fashions ‘f. L THE COOK'S CORNER 40-0-00 llllUBAR-D JUIOB l Cut rhubarb 111 small Pime- 9° not peel. Put in preserving 1mm‘ ii w iwidulato ggllitjrgigcgmtsjfllllgde en desserts of many kinds. BBUBARB JUICE II Use tender rhubarb. Do not peel. Put stalks through a food choilllel‘ and allow an vqlwl quantity 01 water. Allow to stand over mill". then squeeze through s Jelly b3! or several thicknesses of cheese- cloth. Brtng Juice to boiling 901M. bottle and sterilire 30 minutes in Living o Leisure The Woman's Realm I saw a stranger yestreen: I pllt food in the eatindplflw. Drink ln the drinking pace, Music in the listening place! And in the sea-cred name of the Trine, He blessed myself and my hull-w. My cattle and my deal‘ 01195» And the lnrk said 1n her 50113. Often, often, often, Gce5 the Christ in the stranger's guise. Often, often. often, Goes the Christ l.n the stranger's guise. Old Gaelic Rune. Recovered by Kenneth MoOleod. JACKET PROVIDE WARDROBE VARIETY New York - Having a few jackets will add a variety of uses as well as style to the simple basic wardrobes being planned for tnis winter. The odd jacket. can save a dress whose sleeves have begun io go or can convert a leftover skirt into a suit. CHINA HAD FANS BEFORE JAPAN DID New York - Fans are n0 in- vention of the Japanese, s0 go right on fanning, girls! China was doing it in 3000 B.C., and India can show you flat, painted parch- ment fans older than Mr. Gandhi looks In Egypt, "fan bearer to the King" was a big political appoint- ment. Pay was good and you marched in all the processions. We're still making fans in our country, but. not the littie folding paper kind. They were all im. ported and are no more. But wouldn't you be happy with a little goid fan with a real damond in itie tip each stick to wear as a ewe! on your lapel? Or how about wo criss-cross fans in damonds and rubies? They separate into twin clips, each cip a half-opened fan. In the language of the Vic- torian ballroom a half-opened. fan meant. "Perhaps!" HERITAGE OF TERMS Latin the schoolboys headache, and _C!'lC€ the language of the most warhke of all peoples. has left l. heritage of terms that survive in modern armies (says The Saska- toon StainPhoenix in its recent Army issue). Generals, colonels, adjutants. majors, sergeants, corporals all owe their titles to the tongue of the Roman legions. General comes from generalis which carried the meaning of widespread as opposed to local Colonel is a word derived either from columna, a column. or czrrna, d a crown. Adjutant is from adju- tare. to aid or asst. IF you suffer monthly \ hulls u! which makes you Wllllfllllllll Nervous- If you're annoyed by headaches, cramps, backache, distress of "irregu- - . m’?! larlties," a bloated feeling, periods of the blues - duo to functional monthly disturbances-try Lydia E. Pinkhamh vegetable C d. This effective medicine not orgy relieves monthly pain but alsotir , nervous feelings due to this cause. Lydia Pinkhamh Compound is one medicine you can buy today made especial! [or martian-taken regularly it he ps build up resist- ance against such symptoms. Made in Canada. Worth trying! TEARS OF REMEMBRANCE in the original Latin meant the EF°a~eT~ In f-“Ily “me? in Britain seIEEF-m had 5"" meanings, serDflll. "ma-mug. a servant, which in turn came from the Latin servie, to serve. COIP-ml came from corpus. a body- It was toward the end oi the 16th century that tue word general began t0 be used in ll§ Ple-‘flm sense, that is an officer who com- mands a b0 y trocvi 1M8" than a regiment or oonsstina 01 more than one form of the serv- ice The sergeant-major w-fis oriil- inally an officer lush rank. third in command in the only 811d responsible for administrative dut- les and drill. He was known 9119B as sergeant-maJcr-general. The oolonelcy of a regiment irn. plied a proprietary r181“ l" ll- Wliether or not the cclonel com- mandgd his regiment in the field of battle, he invariably super-n- tendoti its finances and internal economy. In the 17th 18th centuries generals were amost al- ways peglmEIll/al cocnels as w_ell. The adjutant is the staff officer or assistant to the commanding officer, and is responsible for see- lng his orders are carried out. Adjutant ls not a rank in itself. but an appointment usually held by cgptflln or lieutenant, although in larger formations an officer of the rank of major sometimes acts in that capacity. BUILDING AIRCRAFT lpnployed alt first on an expert. mental basis, wc-men have definite- ly roved that they can build cra t. so reports the Aercn Ohambsr of Commerce of America. More than 39f0) women now are eployed in productive capacities in the aircraft anufacturing in- dustry. This compares with only 1,900 employed in October, 1941. When floiiring chicken, place the flour, salt and pUpper in a piper bag, then drop in i/he pieces of chicken, one at a time, and shake the bag. This covers the whole piece with a uniform thin coat of flour and is easier than rolling the chicken in flour. A greenish stain on your teeth may be removed by brushing with a, drop or two of tincture of iodine on you: wet tooth brush, rinsing with a, peroxide o! hydrogen solu- tion, Do this several ifmes. It is most important that y:u brush your teeth morning and n‘ght, and if pomible after each meal. Constant expssure to the sun drted up the natural oil in the has; and leaves it brittle and lustreless I would advise brushing iihe hair daily, and the use of a tonic preparation to offset the Tynes. SHEER. CURTAINS, WITH SHADES ROLLED HIGH, AND SIIELVES New ideas fcr summer decoration are beginning to ap interiors. as vocal cm become more limited. Take the windows, for example, those natural centres of interest in warm weather. Sieer curtains instead of heavy draperies axlmlt the maximum of light and air; shades are rolled to the top so that one can see the sky, and l, favorite window-s bay. per. naps. or any fairly wide window- is lifted up with glass shelves t0 hold interesting collections or growing plants and flowers. It goes without. saying that early American and other types of lass look their best when placed n a window with the light mining through But other collections, boo -chlna animals, for example, or small pieces of pottery, carved bird decoys, practiciily anything wlfdn is not too large-can be displayed to advantage in a wide window. Flowering plants -— there are many which grow well where there is some sunlght, either in water water bath . _,,,,,,,,,,,,, One~halfcup sugar orhonoy may A Morning Smile “es-seeseeoo-"ewwv-v “fine 15 ive minutes re B» I? bottled unsweetened, add one in two tablespoons silt!!!‘ 0: honey u. escn cup of Juice before serv- TIIE COMPLIMENT 151g, ’ A lady had been looking for a friend for a. ion time without lic- cess. Finally, s z came upon ner in an unexpected way. “Well," she exclaimed, been on a perfect wild goose chase l all day long, but thank goodness, 5°51" Fqslmd I've found you at last!‘ June 1M1 Playboy (at fashionable ball) - Miss E. Gallant Sec y Martin, Lm: They say that young dob ovar 23. P.E.I. " mere puts all he; father makes on Iladlesz- Just received your lovely nei- back, gift ofthree hundred cigarettes‘ and Henry-Evidently hei- old man is I wish to thank you from the DOM!" out of_a_job_gow,_then. of my heart for sending me such i" a wonderful gift. 0r in earth-and ivy and 191115 Let me assure you that your gift “Mich EYOW in $116 ihflde h? W _was gratefully received and I only brine w any mm a owl wva of wish that I could find appropriate the out-of-doors. words to exéahrlelss my graltlitude. best ————— Here's w g you a the QTEB-LING SILVER 355E FOR of luck on the noble work which NEW META!- JEWELRY you are doing and again many thanks Sterling silver is ussed as them, the cigarette,‘ base for metal je/welry lines that find continued interest in two- toned fLilslies. With emphasis on tailor-ed styl- ing that takes its cue from real glewelry designs, pins and earrinS-i» old most sales punch. Bracelets- and the chunkisr the better — gain additional impetus this sea. son from shorter Jeeves. Neck- TORONTO W. l. The following letter which speaks "I." for itself has been received by tile Toronto Women's Institute fro-n l1 boy serving overseas. Your Truly, (Patriot please copy) SURVIVOR OF HOOD LONDON—(CP) When Br!- tain's battle-cruiser Hood blew up May 24, 1941, only three survivors were listed. Now it turns out there laces axe more lllnited in appeal. were {out Stoker J‘ o‘ R‘ Sm‘ now charged with desertation said BUSY REGISTKAR he drifted on a raft for three LIVERPOOL_ E find __(Cp) _ days, was picked up by a trawler wane‘. Harold wflftmandam he and landed at Liverpool. h“ made 529°“ p°°p1° nappy m ALL-YEAR ROUND SCHOOL that pastrtto yea-rs. As ldaput-Y l;- i l 9 llidsnlfmlled tggoooviillililglgiageollecsisnses LONDON - (U?) —- The 30nd and has assisted 2,000 people w °f Edumllm h“ "Red 1M1! =11- obtam 01d age pensions’ thorities to do what they can r1 keep schools open continllmlsly \ ' ' QDe/énn girl through the vear to aid health. morals, suggesting holiday pastimes, to take the place of lessons during vacation period. Minor-d’; Kills pain. Clever Hand-Made Gifts Your Friends Will Love Bathroom Utility Box Iss7 A dainty bathroom box for soaps and tissues-one that's splash-prod! and gsily patterned! And all you need to make this welcome g1’ is an ordinary cardboard box wit cover, oilcloth ln pretty flow colors-rose. blue, orchid. Cut separate pieces of oilclc he front, back, sides, cover ilscii and bottom-each piece about = inch wider than the box. If cove has a flap, cut in one piece. Now bind all edges with bin; taps In white or in one of th< colors h your pattern, then ti. pious to box and whip edges io- gether along binding u the din- grun shows. With a snap fasten- er your pretty box is complete. You can u easily and inex- pensively make other ‘delight! gifts. The round wooden box your grocer gets cheese in can be pllnhd and lined with eretonne for s sewing lisnd. From s brick and odds and and: of bright-colored felt you csn mnkr DOLORES MORAN — sixteen-f year-old blondo beauty?- ls do- ing her bit for defense. She will be seen next in Warnors‘ "The Herd Weyf’ with Ida Lupino Dennis Morgen. Joan Leslie en Jack Carson. Vincent Sherman directed "The Herd Way.” l! vou WERE DON'T’ WORRY, MuMSY. CALLED so 1 MADE A L 5T 0F EVER!- _.G a GOOD-BYE, 1 TILLIG, I'M PROUD OF wUlLsmrF SNIFF a jolly doom-stop with a gay Meal can motif. Get complete directions for he; and other pretty gifts from or fi-plle booklet. Tells how to ma! inty covers for lingerie u: dishes. adorable toy chests. pre‘ k“'*‘i*-'! '":".=. manv more iirn: Send 20c in coins for your copy of "HandMade Gift Novelties" to ‘Ihe Guardian Home Service. Be sure tq write plainly your name, eddrele and the name of booklet. ltreet AGGIQ be added to one quart of rhubarb _ Juice 1 or n. adding slum filler - rained. Bo! f Florentin Gallant; mgm Th Nourishing supply csrholzlyd nu, o phospiio an Jkil- It'll- flalu. goodness of two Q1“! km. rote us. llier fogi essentials. Buy so digest because they m double- inked. AIldagoodneuoffsmoesGaps-Nnn oereaklneasytosezvesndeslytom whlds GFIII 6I4Z£IVJI$HAKS Remembered April STEWART van u» vzan " CHAPTER. XVI m" “#1111118. ill-it before supper, no was at work in her office, when Aunt Sue came into the room. th Dcidyou know where Judith is?" 1e Xena er woman asked, s bit trucli. limo. Isn't she home?" She hasn't been here all after- n°°n~ 311% 80$ l Phone call — I m3 it was from Sidney-and the m?" ‘hm! I knew, she was gone. I haven't seen her since. Now, it's sl- “"l'.tf“"€°'t"“.° "S?" e ro e . '- Sidney phoned lrl‘€!'q7"ck1y You “y "I thnk it was he." Aunt Sue's face took on a look of grievance, “And. incidentally, I think you might tell me what's going on around here. 1 may be t flft, but I'm still too young to wutterll ou mean, Aunt Sue?" shelved!" you and the Jud e prowl about the place h e - en. this morning, you and he and Sidney have s mysteflous conference here in the oi‘! ce- Wfl-s 80in: along the hall and heard your voices. Then Sidney drives of! with Judge Daingerfleld and, later, you and Mont go into Breokenrid e. When you get back, you act lie clams all through dinner. On p that Judith disap ars. It's all mo much for me to ure out," Aun Sue concluded. with an air of mar- tyrd resignation, Anne hesitated, then decided it would be best to explain the situ- Mlon- A5 briefly as possible. she told her aunt everything that had hap- pened. The older woman's face re- lectcd a mixture of amazement and concern as she listened "We must find Judith!” she said, when Anne had finished. "If vou think Sidney has fled. and if that was he who phoned her. she may have run oil with hi ! I'd better phonle Bprlingbrook an see what I earn can . She hurried from the room. In s. moment. Anne could hear her talking over the phone, When she returned. she reported. with relief “The cook told me that Judith and Otis have Just left over there. They're on their way here." She and Anne were on the front porch when Otis’ roadster drew up before the house. As Judith leap- ed out of the car, they could see i that she was highly excited. "Well Amie!" she said. halting st the foot of the steps and glaring up at her sister. "I hope you're sat- isfled-you anti, the judge and your expostulaiecl. damn jailbird "Judy!" Aunt Sue "Stop talking like that!" Judith stamped her foot, "1 will talk like that! Sidney told Otis and me how Anne accused him of being a thief. He didn't take that money from the safe, but the Judge threat- ened to send him to the peniten- tiary. And Sidney said Mont Sher- lli-DYW rill hit him with b“; m , 8110 suddenly b t will“ it was s dirty uuirginl-Ilw “ml 1"" "Evldenf-ly. Sidney U118 Jlacts." . n n~ _ 11w nothing a 5.. Jvliaplviwiifilfifi‘ . til seoo ' 41d W“ u" gwmyllginpilalafilitsilrlrilfy pogket Bligh handed it over u. ," u ge." “sum owner‘: "llllsidhuzuyyrgfyed her Judith gulped baok her ram wig-Rhos gone away. He said h; ever coming bBclL" Otis had climbed out o! u. l-‘oadster and now stood bead: "where's Sheirlll?" of Anne. "I want to mhZsl°7-“““““ Anne noted. with a stab o! sp- iwc e a t. , eiuliubigeiaygiaslzgicig%y'liat the Dock a . no art in this sflaii-(lgtskthglrallll h“ " WW Just t i < ' him!" Judith blUSllyllllI‘. “lguihygfi gave gkolt tohget rid of him—1 won't ave m | no i fleetwood iserllalf at target ma" We 59m‘? 55174‘? l-TOI-llld. here, am; éhgfillnl-lhnfl-F you ve got to lire Mom “Judith. you're tired and u... lining. Aunt Sue put in placst. lnzly. Come on inside and go up to your room." * has i“ AKIN‘: 5:: It stupid far , 1—-\I'll go and Join sill]. Anne's patience gave way t4 anger. Judith Biakemore, you are mil-KIM 9' spectacle of yourself!" "You're tne one thats making a o; Sllwlwle of yourself! XOllle on. about that OOIIVICF-LIIEI/b what's the matter with you|" Judith laugh. ed shrilly. "That's the truul. and you know it. Or maybe you don't know it!" Anne stiffened. She felt the blood dill‘- to ner checks. Then, utis spoke again. "Judith ls wit-run ner rignts mie owns iiali the farm and, lA sne says snerril! must go, he must go." Annes eyes iiasneu angrily. "I'm in charge nere, runner-s uni ma... mat plain. Anyway, Otis, you eel‘- talnly nave uu ngnl. to llittx-kfifl You'd amplify matters Dy leaving. Will you please do so at once!" "Not until I've seen siierrill," Otis sold aggressively, "oudim is my brothers riancee, and i intend l0 see that she gets Justice." Just then, lviont appeared around a corner of the house. He strode toward Otis and halted. "You're seeing me now, Frame." he said evenly. "What have vou I0! to say?" o»... was momentarily disconcert- ed. Then, he gestured toward Jud- "Miss Blakemore-ltfiss Jlldll-h Bis‘ re—insists that you leave Eastwood." Mont turned to Anne. "What are your orders?" "That you stay-that is. if yo“ wish to stay" she wld him- He faced Otis 8811111. clenched his fist threateningly "Beat it," he clipped. . d Otis backed away. his right ha" in his pocket. "If you dale w W’ ‘ hand on me. I'll shoot! "Get going!" Mont took a step l0" (Continued on page 6. C01 7):, Nléedlecraft/ For The Home Wouldn't you like to MW this lovely ensemble of own and bed Jacket in a dainty or batlste? So easy to make! style N . is designed fol sizes 16, l8, M, 36, 38, 40 40 44 I O snd 50. Size 88 requires 8 I4 yards 89-inch‘! flilflilc with g aids lace de ng, 0r gown; - lama with 3-4 yard 1m edsins for Jacket. To order pattern: Write or send picture with Nu: nsme and n1- dren with 20 cents in coin C stem to the Needlecraft Bureau. char ottewwn Guardian. The Charlottetown Guardian Needlecraft Department. style No. 8847 Size ......--.....s IlIOII-AMII Illl OUT TIRID ACHII “Ufillslli 1942 \“% iteiraturel