PACF r0012 rung CHARLOTTETOWN GUARDIAN 
     
     :1‘.  . ~  t, , m. t, predicament 
     
     1111s ’ """“'“" notes 11v r11: win WORDS OF (i, ’  h,  
     
     . MON t 
     
       A German torpedo at work 111 the St. Law- -——— The reports that are 00mins 0" 
     
     A . . i. , . n1 possible side- 
     
       l uull tl-‘ountled tn lllll r°nce—wh° ‘Vould haw dleanml o‘ "i?  um oo little. we believei is g"  txiaclktw‘ omgiliiissolihi. should 
     
     ' rllll ’Y . -. ~ ~ ~ -v' ‘c. ' '1 c 1 LLC - ., , 
     
     1 o s i u‘ m a‘ Maui" colllplacelw)’ Inuit gilc ‘indie l0 ctelna Hgl dill. ligigntgiidcilgmliléaiisl!‘bglrrgiigrii wiiiui vicililipthlvlii i132! 0%!’  resiiiitiwrthwgruiirikfivxtseirgdeiiesiiiiion 
     
     1» .~li‘ll. Lleut. col. 1'. ‘ H t, overshadowed by repvrls . ' in tlu Mussolini. an ns 
     
     wit; President: s. B. Burllfll- '44- Owing to tl1e U-boat nlenace passenger traf- munmnnmerlca 1s got-nu to do. g,',‘,,,§“‘:§°,,,‘.§§2}?;.,§“ {snail s bihemrilent heeded by Mo"!!! 
     
     - - Lu-ul. Col u. n. mar-mum Ill-li- - ' I d‘ ~ d Brit- Ann by say-mg that we do not bz- d" g"__flggb¢1-g Bu ogllo i! that would serve his 
     
     fidsniicrrtiirilhflsuizslslng lbuectol J It. Burnett. IJ-l. ilC bEIWCCII here and the \\ 8S! ii l€b Elli imie me piesflii Quip“; and the Trmfzfiinfi, Qgzémor of Ngw RUXDOlh-It certainly; ullilgllid  
     
     -... . . _. _ - .  .m.. - - » eo 
     
         “" “" ‘ “""""  "“‘ “‘°"   "' °  wlsssmtlszlt. h“lsl Yo“ 8*"-  sl: :h”*....:l.:l..'1 nnibtlttvl 
     
       .... g " - * ~ - installs "t.=:.*:°":..:"s2l.s1lt shssmtlsztt= .12.:  
     
     .  "lll-éllllllililm" . - -- - dt detro c 
     
     s’ “'21:; ififili 2.321s: £31311 one month The lntroductlott of confsigrlptlond rgieansfi ill: ilgivtiisliiiilfiioii: "lgiYSQ $11‘1°&1-§"1‘i‘11°$cr“<§l°t1n° lonvls-nd. 
     
     . . . ' ' n uca o - ‘ - . . . 
     
     um Delivery ssbo per year. $1.011 Iorngnmllllll combing of ‘government o lcesuiie ca abw Sui? {g1- ctiimirfiipiyée viitiriigygloilirilienri  PUBIJC FORUM Maiiéngwnbthvihgiru. pinmim iiieii 
     
     $145 m» 3 mouths; we for one “I 1nist11t1o11s w ere womcn Can q i P , l iareégsi iiiiermediaie - wiiwiimmii "i. “i.” i. u" u, m hopes to £11m Victor Emmanuel n? 
     
     5, 1111111 1n other Provnlvvs Mill  5i- ‘:-  zuiu stuutc for nun-power. As there has been a ow- aim piimi in me Biiiisii Empire min-i" i, “munfiflii: iililgclaoiisglbhapgllitiigaiingegieieiiililgliacz _ 
     
     “ma” ‘lam’: aw" p“ yeuths‘ u “mg ‘if lhc medlcal lest‘ "cit a few lvho “we Wm‘ pallmllmm’ mlelgslea “.5 Krsilfexus-rouairdfitrsec n1 It wl-s the connivance ol’ this llttle- I have been asked by the Domini“ 
     
     suc- 111 a moo ioimeiiy i-ii ciiegoii. r-Cl- iv," no“, 51nd [hgm- yiri-iiicitihcmvlespiliglililifiiilifiliibifgd iilifsflfiij ........n, “as: o- nlllfll iiliiildiediomonarchighligh iitigiuifitli- con] Administrator. Mr. James McGregor 
     
     n1» ousrlvllslvll“ "“",'_‘““" P" “Mfi“‘§§i"i'ii"i flu selves passed for active service. “corks, 011g runs; l-ournlh-st 1.€00_ " "mm." ‘Iherenis iiblniine lnstfsnoe 0P1...‘ Stewart, K- C» ti! ‘Will! t0 the attention oi 
     
     Hut-Ills; -‘~“"i fjff§“'-i.f,',','jf,' fifftmaau Wuhunoe. " "‘ ' "‘ suns 11112 savei sBirii-iliizéd Agicliliisils action b the kinti or royal family the people of Prince Edward Island the ne- 
     
     n on: ~il"- . - - - :“‘r'C-. ’ ‘ . 
     
     =“""l:°“‘ "”""-“""“'-" 0°"'~1Ai-l.'§§l1'1a1“:is-:1m': Us‘ °l k°'°~‘°"° "T l‘°"'°°.‘"'“°'°'a' "lam" m" iaiiiii merirclsifrvetlulls 10?; lo the 0.1mm ACCOUNTING Tltnlvsrllll iibinchbeyizilezatltifg w 31353351“? @0550!’ 0f avllldmg any lwssibl? shin“!!! 
     
     zlifii-ilirififl§i_:ii_‘;"'§;iiffi1i_f1"Th3, M," ,..,¢ sun...“ gines has been prolnlnted. 'lhc order. 1ssucd by lighting forces." The Prtsldsnt wards the resent calamity ot‘ coal throughout the next heatmg season 
     
    
   
   
    
     _ . 1 1. r . 1 1- 1- 1.1 11 -ub11~.1t ' _ 
     
     Ont; 11-11. 1~..1....-.... suns. cunt-run u. 11.1 O11 Controller, Mr. G. R. Cottrclle. of Toronto, iiliiii-ieiiiiifi- oiibigiiiliokiliivigidtiti-e heist: miiriheliguyi-s onligflgiiii s”; o; dub wiigiilisiiér? iggiiilolvritvfylicotihlniiighértgilf by taking delivery Now of their w“ siiii 
     
     d n 
     
    
   
   
    
     . . . inn 
     
     - d approvcd bv Mr. R. C. Bcrklnshalv. chalr- letter to a, Trade Union official he 111g 111111 monopolies. namely. to people at want to mm 1n this ply for next winter. 
     
     " ‘ t llentor ts Weaker thflll Ill a“ - . . . .. - . . . 1 - _ 111 n; t; - 
     
     T“ °"°""“1v‘..t.n"111: m" of "r ‘loom ‘domes Comm‘ 303"‘  5:11  22132.‘?§§£rl§‘1ll‘lfv.f;‘lsin.°.1123cH5"1§$.l1;!°1l‘.’tl§$l“‘wl§'l‘§l°i? 
     
    
   
   
    
     goes into effect immediately. It does not ilnril)’ voted to war purposes. are sons ftxom Plctou to Charlottetown and 1m 111, 1w; Wuhan; 115mm; The rim; a] 05km at "Se," is 
     
     - ' ' f ' ' 1 llwa lines 0'1 the But th v t a] it f the It- p p  p 
     
    

    
     .1111 llSllAY. Mk1 1-l. 1942. to use of kerosene for an)’ Purpose by the armed ilorliliailiéliiilipgcfllurlgigiuféig ‘£12: tisstipgdtubtgmris siyaighi as Divisible’ 8mm epieasiiii: itilirosy gi Germ one of transportation, and the danger iii 
     
    

    
     d” forces of Canada and her Alhes. m,“ ' ' ‘ one rlccn cnarlottetotcn to siriin- silly. is lgwed theilenselveisi to lie iiril- any fuel shortage will be greatly lessened 
     
    

    
     "Oi" AM“ Task A‘ Ha" - '- i i ' - - - 1'11 EiiTsTtavancca nut ‘ffbsi/ltllfiahiilsrlilgnkh m m‘ ° °r ie§v§1eu1”to't’1ll§' w§§1a”n1‘1'r=“1?ut $1113 ll’ consumers will take the sllszcsicli nrc- 
     
     _____.--- _The war ls Plfltnlg havoc _w1th lIbYEYICS and a mocwi-riiiliiilmpon Symm eunuch ime CPR’ ice“ siimmips iii mam in i mm”. ‘i. home caution of stocking their coai immediaieiy, 
     
    

    
     Hie (iiiiiiiiiiii, i111ru5i0rl in the St. Lawrence kindred Intellectual mstltutlons 1n the Old lng the U.S points thmugh On- would connect t-he Island wth all rum Wiiiich they Ill-VG l0 JIM U161! iiisieiidy of waiting wit“ the rush period 
     
    
   
   
    
     . .~ -- - - - . ' t r- r11» 111 lJIdThmWll/W- 
     
    

    
     of an e11c111v >lll)lll8l'lll(‘. and the offlclal lntlm- Country. The Llverpool Library, wluch “as the {fig li-iecliiiiisige "aiiuiifs °iioig “Sgt is‘: iifi°lalgiiliagd°ioiilie c“? ii” iiiigw The Italians are min! m m" w ‘ the end of the navlgaflo. “alum i 
     
    

    
     - I ' ' -l - ouncement of their first circulating library in the kingdom and l5 cm to ifave be=n demonstrated. lu'e ilesdom from cus ems Duties "81" this W" "B!" llimliilh- “"41" l 
     
     alum m“ W1 lint,“ daunl ther with the reputed to be the oldest of its kind in Europe Edeed it must occur to the un- on all ‘rnpxts 11nd the Island wzuld only choice ls ivhether hey are go. 
     
    

    
     “Millie ‘Wlllt L’ m“ e 0.5a . - - ' prejudiced OlJ:ET\€X' trust rubbe quickly beccma one or the mostlm- _ . 
     
    

    
     fun..." out 111' gnsolcne and o1l supplies should 1s to close at theicnd of this month, after I84 and gasoline iiionagii makeiim- iiiiiiaiii iiiimifiiciuiiiig ceiiiies o; tgufitsgie ctiheeali-iotgerrguriviiséiliiiésroiliigy  A   
     
    

    
     i.i,ii>i.hi.\.i.,, 13K- nnnt lftisst-z fail-e in our midst to years. The llbrarys 70,000 volumes mclude many perahve the rsducl-vn, rattler tJ-e Dom n on, lmpoz- mg row mat- ' i ie iii the || q i 
     
    
   
   
    
     biiciiii-Oiii man the lucreaslng, of motor hsu-- tcr als Ircm abroad and exporting 
     
    
   
   
    
     ~11 of lllu fool's pztrzttlisc in which all valuable first editions and otllcr rare pu “V0710 Wlde P909195’ W" 
     
    
   
   
    
       
     
    
   
   
    
       
     
    
   
   
    
        
     
       
     
         
     
    
   
   
    
           
     
       
     
    
   
   
    
       
     
    
   
   
    
      , tic ll l' ' ‘st-L. ' . 
     
     3.1.“  1, _, 1i -i',,..l Que of dcadgniflg in- The fate of the stock of books has not been thine lilaosigtiiterquarlfrrs ills»? lg]; mTiiii dilxllgntclqsltas suffered ever belgiy ilgglgflitiflfl hffij‘ Ffiiflfififi Premiu- 
     
     llsiW‘ llii-l ~‘“ ‘silo ‘ b‘ . villain; the openlrg of such B snce Confederation because the re- m min m i? h; Wm, 
     
     ‘ ~. '- l1>e11 at work here 8.5 ClSQ- Btttlfid- ‘ . , . ~ z 1m edm - i {Ont 1 d “bu; com“ e n“ w R 
     
     tlttcucts . .1 llus t _ 1 i . i * II ll traffic user). Callaca 1s I3 _ K qulremens o _sro an Q a good deal o; enghunum m m, 
     
     ‘vim-i. 1m.- ln-en the cnrnfortmg reflection that we _ _ the joint war sitar-t. is both ln- have drifer-ed entirely from those hunting down and 514w“; o“; o; 
     
     . ' , .. . :. '- 'de God 1's in 511' Thomas Henrv Hall Came English novel- silpiwfiflble and "-°"“5~ I" l5 0r ll" Island- I“ 1373 “wit” i119 Nazi liiiflidfli- 
     
     flPWl 1W1 \\“ll.‘- “"0 l5 o" m" 5‘ ', . _ i, i _ 1 i . patent that, in case of leal nflces- Quebec and Ontario manufacturers 
     
     m. 1...;..-s,. 1111.] .111 11-511 cnmc out ultlnlatcly all l5! 11ml lirialillallsl. dlsd ills dalc i925. bflgml life slty or emergency‘, freight ign itie needted tsilitrispirsrectilon t1i1e cry not; o1 Life Tough 
     
     ., .  - _  -. ' . - - I - 3 - :11 1n e “ e r man ." 
     
     Y1K?" l" ill“ “Wl- 1”“ "l “uh” l” the sophlstrl as an arcnieft’ finicfcd Joumdllsn" but. filmed giilplfiodsiftaciiielgnihiicutih Cansd an il-ells lclgrtainly tliiie fir’; chaifne ' There ls s. real lesson for the 
     
     of t1“- Unittn; the coward at l1cart,_\vhc1 socks i0 ffiiiiwv“ ‘vmlngn’ (t Us outstandni-gnfierles are territory. ‘lhis qlié5ili0li, tuere- from the point or vlew o! this whole world in whniti hsnnmeo ifo 
     
     '1 l“ onwicnce and iustlfyhis iiiaciioii iii the c Deemster, The Bondman, Fhc Scape- got-e, 1s not 1;_1vo1vcd 1n the sen- Island. ony ln the reverse drec- the German and an neon e. 
     
     500*‘ l"? _ ii - . . . 03in “The Mamiiiaii 1- ttThe Christi ii» "The @1111 presentatlon of those seellln tlon. Let no one say "lt can't be There must have been msnv o! 
     
     face of l11= tramw- men. Time 1s not on our Sldfi, g l _ ,, i, ‘ ’ . ,, .3 ' me franchise mentioned. 0n the done." We are on island, littering them. Dflhfl mlllllm! 0i the!" - 
     
     C -_ - 1 .. . “(We ihe 51.‘. but here seek. Eternal City, The Prodlgal Son ; i115 dratnas 1,5515 o; the pertinent facts as thus essentially fwm the r-st of Can- W119 knew i ll? this dkllmlshli? 
     
     . ‘ml l” “m m "ml?" a. ‘- - ind film; includ “Th I“, H d" d “Th 1111- brought out, me auluorltlcs ndn and we have our r1511“ business was all wrong. There must » 
     
      n    o slog-v “"1  i»... n.- ~.. 1-“. .21 c" 5*“- a" s " new  “r  — Hm-  ~~=~  “r11 s1"Y.rs*"-ll.:.l:s.n: 1n n 
     
     and cvcrvtilwvir \\'lll not uitlnlatcly be all rlght i 6 _* m]: FBni/liiiiii ifliifli ii l" _ if)! 1"" Branttord Expositor. ll.K.s. lll-IMMING iiiiifx-iiiiilfii Wis i0 démiy iii" ii- 
     
     i-ni. ihe (ihfisfiiul wax of hfgnunless we become preseinting i e rltrsh liutlors Assoctatlon and Tom“ wiimiwiiiei, iiiiiiiii, 1, THE Ki-LTS Aijn THE JEws wciuldiieventuslly create s. terrible 
     
     Gm“ "viii mni “do ii iim“ nego 1a e _ crms w1t _t1e Government regard; mflmiwd by enemy gcglon have ____ ca am y. is THE TIME To ORDER 
     
     . . . _ . But they held back. Thev dld not 
     
      .. 1., |  wicl from the press a iiig Copyrlght, “as ldllglilfid the same year. been Elven a _nc-vel lead by the sin-Your cdltorlal note. answ- 1m Th ii d ma; npthin 
     
     Tlull l=.1~  “l” bii‘ i T i iii 1- e e 1t entcrpnsln! Thames-s dc bcrollgh era Mr.J r- Poullotas to the atti- £15 other hyoulgpiurn upsotta" savg 
     
     re111:11'l<.1l>lc lutuls ll)’ Hi‘- 01113’ r aY or: . e . . . 0i Elm‘ l.“ KP“- Emh h“ Lufn" tude of ‘Highland Regiments t0' th m. ' 1 
     
      1r. s.   o  Gmmmii .T°1.?I”“‘1°l‘-“’°“ »‘°‘l"3’-°  lliim‘ l‘°"‘°““  lléfivéfilir’ 1:1“ .ll‘"l-‘él1‘é’§§‘°.2'f1.l‘l;.*'f‘l“°‘ .1. ma’ ‘"1"*=..":"° Win17‘? l: Ylilli‘ Willi" 5 003i slllilllll ' 
     
     bH-"m [INTI Hiulhliqlli‘ "Hid Prlfisldenfi Rommel“ O . p.“ ‘c reaiiiqns’ me.“ mg p“ wit)’ he Com- mole ma" 200-030 W091“ Nmmahy estedyln another ansgiver whltiitells vainllyngngniaooilghleyetrwllcci to ‘do in 
     
     (‘lCClFlTZHiwfl of \\'nr. It 1s entltled ‘Tune Runs IliISSIOII on pu lcirelatlons offlle Federal Coun- the borough dnlws its watt? 1F?“ to be round in Lt.-Col. C. Beres- the international arena. 
     
     k I L 
     
     , l. , ;_ ,, ,1,” . . . 1 i, ' i is "n; c1l of Churches, 1n co-o eratlon with the Inter- 01° v05.‘ “°l'“°" ° 5mm‘ ford To 's book on The 42nd Bat- » BEST GRADES OF NOVA SCOTIA COAL 
     
     (>111. an I . 4.1 t .r. i11111t unlulu, that tln e iatioiai C0 ,i i R i. P iid . , k Mctropohtsn Water Board, but re- iaiion 8D E F Royal Highlanders Crime compound". 
     
     1  . ' 1 1 u111 e11 l -- .- ~  ‘ 
     
     0“ the “h “lililhi (imimn ‘lcmijitracle-SIC] If? illg 011 a pubhcify)’ llamiiagbll: foruccélitlci-lcl-iuiieiiotits icfnliiildéiili lffllnniufslllleygigrili °f can“ 1914"19l9' Instead of standing uo to b'ot'k DOMINION HOUSEHOLD COKE l 
     
     ;]<>;|l"< 11s {.1111 11m"; p 1111s were a mappc Ol- _ _ _ _ ._ . i i. _ i ' Q11 pggg 14g coy Topp writes; i » . 1 
     
     ,,.,,   ,,_  his first  M,   n. .11.... rcl1g1ous our... especially lgslltblt 3539.25’. llpliré°il5rlil "ll. “if”?s“°"°nt”““'°"‘“f "l; l3?§l3ls*".%.§llllllh“llhllhdlé: GENUINE WELSH ANTHRAHTE l 
     
     “‘ “ , i ‘. . . - - -_» - . ’.-' l _ 0 c "o m] " ' 1 
     
     Ta\ll>1' rwnnr. 1.1111 illltlcr planned first to Sllb- derglmml’ m ‘he has." _°°"5'd°'a“°"s °l pubhc m“; ‘griie   ‘filfihlilnfiiifg 31111.. t: the wliollegof that (ganaldhon tlrrltriilnitiiitwhwdhogi. loliozgthrecicebiis ‘in Cobble, Stove and Nut Sizes 
     
     (i110 Fur 1:111 tlill not lntentl to enter upon relalwnsl the suggestion“ a5 to the PmPeY 3P‘ E3‘? urdusiti-y ~c for publl" bath- “FPS and willed 101' the Battalion able z 
     
     n.   .. n. n.  or or PW" l" m‘   l“ loll“  *1   ‘also  altslsstr:.:'.l'1ll“§?lz.  uz"s.rs..ls.s.lrp"'t.lethal.'21‘: D- L- w‘ W- “BLUE” "AR" CHESTNUT 
     
     . . . - - - - - ~ r 1e 1111:. n . - e m- w 
     
     w“ '  z "cs 1111t1l 11c ltrlrl cousolltlatcd lllS ililgililcsls-Ofimliiégdiigiiziiidilt (irflftdltcln df pubhclql ‘tllxfougfuthc “wgiéra frcm three of Mangers Wlls the outstanding event is 110Wi Wlihfia iOUFB Oiiifiiimbegd 
     
     - o s an newspa er wrl - th d p wells found to be in t e record of th Batt ll d '- 0T0“ ° 5 i’ n 0mm» 5° 0 , . 
     
     .1 .1.-:,. . “um the (M Fngkind rushed it... ers will be quoted o1l defects in church tliublic re- Sillelabl: 1°" “ring?! “Qdii°g“ldiii" liliil ‘Mimfmli i“ geimllibecl? "illi- ;',‘,*,*;"-,g?"§;;; i’ ififllag‘; ntgghgglgq; Place your order now for Dellvery durmg the 
     
     '  ‘~ "“ ‘ ' _ r . , ec.c were a- s. , ~ - - - 
     
     Gm“ ii Mm“ hi. iii m“ ii“, yeiiis and upset latlons methods. A friendly Press 1s the church; 3‘;¥,,,f'g_;gs;g,.0e pumpii theymosy “fill  f-fffiifif  bifiiifelaijfiigi lntigoizrhe  ilgouglil) lisiistrgbisé undo next two months. By dolng this you can help 
     
     the wlrfie iutulztnlctltzll sequence 0n which the greatest assel- ‘i i‘ i“ i‘ gglqigilitiiiiinzllligoegi pitiolifgiiotf glgiicililge $13168; tzoitwiliiiiiaoe ein the Melilcourt the woigi eoi me damage they we keep Canadavs Mines working at hi“ capacity 
     
     ym- ,-.,,@.11l<.,1 in npcrntc." England prepared. H, h i i _ _ The “e11 serving 1t yields 20.000 gal-i counts} lying noniiig‘? o?  mgliiifllftfiéfi-iidi, have mi, iiiiiiicm and assure yourself of next winter's supply. 
     
     \\'.'l~ lllvu (‘owl's ill~ll‘lllll(‘lli. ‘g 50100 and wllege 501001115 ‘"1" be give" 1°“ °l “m” ‘"1 li°ul3 and l‘ U“ Ridge." col TODD then describes about the way out. 
     
    
   
   
    
     - - - ~ 'ts to work in non-essential itd t ' d - °r 17900 5mm“ °f ‘hlcrlnaled the expmll- Lieutenant 00h ll d Th it ii ill h 1i ht 
     
     \ 1- 1 - t 1- z uformatlve review of Perm’ l "5 "05 "l" . s e a“ e l‘ “"5 w‘ “e l0 9 . 
     
     \ l» nlliiuiulfhiit"iiiiinthitl] clurrent issue of Time lng summer vacations but not for a longer per- mits‘: wehcigrgn egisvll“? setrgg hgcfifislerlltrllietllifillfiéeirilttll? iiiiitiiewflieyiuvhllir htialiey itieilglii ‘till For the Best In Coal and service ca" 
     
     ii.1,.-,~i' hi4"... 11s to the present critical sitnatiqn loficDcferlce lidilnlstcr Ralston said in the House igiiiléiiiiii-liso-ielniiiliii ooililiizaiigilif o-‘fuilvfie- ttegemy, wok tlirec prisoners whom Sillliiiilll/fl “Slllierigrii-iihat firshh ill 1' 
     
     .  .‘ " ' ' ‘ , _ ' t _ ‘ i ' t, t mac ne guns an a epard er- 
     
     m iiw N. imivrpiicci o ommons urlng dlscusslon of the war ap m. can be hid [oi diiiiiiig Wei ey sen o the rear and then ie w“ P 
     
    
   
   
    
     - ~ - . . _ i , Y t1 d . nalla of modern horrlb ,  
     
     .\'11w llfzlr-r Is prcpzlrillg t0 begin the inter- propnahon hm" HF Sam'- iloweiier’ t-hat “more §§l1y1§°ii1r5lc¥l~ll7nilliivniaiivrtsgalI P03201201; on w Lake {our mo” ihnb: ilewi °f ‘gem had iroiugm m 
     
     0cm‘ “in: ,_iiiiiiii_.i N“), mid iiic Lips are his glen iiliierreinecded 1n n1un1t1ons factorrcs, 1t was ioiii peiiieid iii. iiiy Emmi SW3..- i_Tli3i:iDé%ii151iCql.Topp cnnnnnss eifiiiieg ‘ilfiiiiiilgiai iifvglsiigiivgiliiiihgfi‘; i ' , 
     
     Hll>\\(‘l' 11ml llfs fillztl ivlzlv for world domination." .51“ e “at sludems be enlPlQYCd "l the “Til” mm! 9°01 WW0 memlme “We a en “w”; sent m5 fir“ they did 110i 
     
    
   
   
    
     Jobs rather than in non-essential industries. The ilfpfliilm“ c‘ mo” " Fmm ‘he batch of prisoners w Hanan” "elm" “l0 W" "Si" ‘liilnlnd 
     
    
   
   
    
        
     
    
   
   
    
        
     
          
     
                
     
            
     
        
     
        
     
          
     
         
     
       
     
       
     
    
   
   
    
     There will he a simultaneous attack on Iceland . . Y - - l m “Gum”, Bulmln- gelidqllarters before even the re- evll when it was still within limits Coal Dealers Since 1900 
     
     and the North lrclnnrl hnscs. And this time there  “asi alilswermge COllliPlallllF made P"- sec c‘ i i————ii n b “i Ger gfiliélligifafilelg figviliifliliiigg wit: OtOXTII;  which we could have dealt with ' 
     
    

    
     . . - - l r - r 1 orma o o - , , 
     
     wlll be n11 attempt t0 mvade Tirltaln. \Vl1ctl1er and 1g ygags ‘gieangeilirergshlinl; 531d Elm-lei“ l7 m“ aircraft engjnggrjng was s“. was typical of his tuoroughgoiliitg We are learning. just as men have Phone Z40 
     
     ilillvr <111<c<1~l< \\'lll not rlcpelld on the Channel g caPPf and COH- ured by tnc Brnlsil Government Hbiiliy and pracncal enthusiasm always learned. blt by btt. by bitter 
     
    
   
   
    
     0i a  Oi He" on Biiiish and Ameii_ fused about their prospect for summer cmploy- when 11 South Wales cnguns over- “All ranks of the Battalion," “m. experience. We will not likely make 
     
    
   
   
    
     +15 _ _ ' - - haul factory rebuilt a complete the diary, “are ju t1 d all the same mistakes at the and of ' 
     
     can soldicts quartered m England. It iciertalnly ilizziislelnfifgy thgousisleicigf‘  nlsifgeulillizii? fiBTXLIIBD aero-engilirle atinms Gill?!" “chle-"giliilnil "n50?! gvgligéld 5%’   Klgitgfi‘: ’..Z’°,.,’I,"9,E,,‘1‘§bf§“‘§;   
     
     . "' .1 - -ss saresan svsc er 1 1 
     
     does not depend on the Brltlsh I\avy. It de industries‘ n ‘a Ffiie coiilii-iiiie eiigiiiii 5H6 limb 5 com n“ °n °l what l‘ kmw“ l“ make ls to waste pity on anltallsn 
     
    
   
   
    
     pends’ ‘imhiii-Taliiir bcii1€,‘ies' to" }I,°wc,,"§,‘§°.: * * * " Zllféwnifffikiduf“ 2i Lhiihnligrs‘ $33533“? Qicllitiin showed 1% 111's igyirlttgiéliluh btliiiic "$1232.? atm 31%‘ CAROLINA ncormr v 800i“ scour srsrrlllgoii H"; onus 
     
     power tlc . 1m rt 0w "1 er o c nc F . . _ » i. - _ M . ' Ell all e execution of 111s o; the Axis acuong - IN N0 A ' 
     
     against linfilrulrl. ltdcpcnds 011 tllcwar m Rus- Tefiilsrtougiaancci: PlQiliilliPi. Lliliweral tilclnbcr for iwni-iieithficfiipiiriléilgifieigiig-  pilizisiriliya 3:1; iniplliiig tip, Ciliiefi-ifii) OPPOr- thThereItlfiin very simnle test for LIVERPOOL N 5 M“ ii _ IDNDON my” iLicPM on], 
     
     sia and in .\‘<1l"tl1.-\tr1ca“to bcgln with, and whe- E - ’ . c l .c 2mg l e asslgllnlellt 0f 0i 5116"" Plcdlwllm 0mm"? vantage the circumstance 8i“ ad‘ s §1S°an1 Eaiiihs who tileslesrve our Visitor from the Carolin“ of the in the Auxblary Territorial 56"“ 
     
     iim we Cm iiii iiie Nazis simuiiaiieoiisiy on dIiQlISlI-SPCHl-(lllig officers to some French-Can- hmufpr when, (‘hey descilreo sshfa moment 1. e5 ° m’ iiliiiipiheyii. i.ine:“i?:i'ii_i'ilii?:°iq:'?i§ Unnedfistnggg to Queens countv or are to have omclally allllbiliiifill 
     
     I ' i , _ , , 3 ‘g i , - rem a e aclzevemen ." '1 1s -. ' n --_ H1 o e 
     
     wldcly separated fronts. Our fighting, divided 1n wolzfii ‘L’: fi- isii-eeilvilsiie oIiIi-(igg: all}? allmolieiiuiciltz"  lav"? 0‘ $01“ rug by me tieagiriafiatgli: Batitfrtlloncilxifwirtitifiitiiiii: :10? m. m. mo“ who o" not M‘ xiijelcsitart-ldeltlertvbohlearlsptii-l:  c§1f§§n§“é§i‘nm1tt§§li§~”111sricher 
     
     w . ' .' ' ' ' " ' H] e Q i‘ t3 SE35 IIWBYS Si’ ‘OIB- i -i I} All" 
     
     SPITC’ kaolin“  (iliI-(lid l: nmflngiU S 0d - conlmand a Highland ftglliielii inpp Toronto. mm‘ who“ wartime wmknh“ gam‘ iligolirgritigtutngflieilgrthid ' ' ‘Perhlpi DEEP ENOUG" iiiiisentinsivglingstisitigs  papal;- firtilggwlhthnsllll’ tiliiisiéillltch  
     
     - n. nut 7m 1 ‘H hum‘ nee 5' ' - ' pr uc Judging 5mm Fxfllllliig facts in the first World Al r m‘ ms gicknaiitile Meimani Bil. however, was one eanije The deepest 0“ We" l" "i! World Agenb for the (Yanadlan National gpifltug] welfare and be ready 1° 
     
     than liiiilllualliiliegdlhs iilrlllftir gitildilltiiltiiirgiitol: War, (says Montreal Gazette) the reaction Brltliqerhlti-e routcYErIrcriiOgwTd-eeri go from the rormer Brigadier. Mgior- 3K1?“ m‘ than m,“ Wm down‘ Runway‘ M Livezpiol’ l! m“ ‘m: m“ a hmd it‘ "illm" my o! m." 
     
    
   
   
    
     . .. lB-YIB troubles and ris 
     
     . . _ y . - . . south lurlca and the unucu States 0mm‘ 4- 0- MB/"iwlflid- 0- B.- .-_. __-__.__. m’ Rwmum“ rifle Y“ ' 1 
     
     dlstances, wllllc the Germans strike at the Brit- “ imld hardly be “hat the P°"ll°l qli¢5ii0li im- to India, ithese uncmzed merchant '3'- Mr 9- D 0.. then com- _' M?“ or people (mm t“ Caro 1gb“ 
     
    
   
   
    
     ________}--— 
     
     - - ' ' ‘ . iii 
     
     ish Isles and work down the polc through the PM“ Many Jews Joined the ranks 0f Illmllreal Sh!“ of he a" malnm“ “m! mandms the l“ canadmn Dlvm” m’ o! Nov“ sco a a JUST SAY UNCLE 
     
    
   
   
    
     . . 111 cunhettrllm _ ___ 
     
     i _ _ H - , _- communlcdtlo r E 1 u u -1 who wrote: ‘Well do . 42 . “m” t“ “g “and _ . 1 
     
     he“ iiiiii’ iiie caiiciiviusi in", Iraq’ i0 iiaison lghland battalions, wore the lults and rendered a“ me meiiiiilless on W12? qiasircyzglr done, old cctlen, I rileerewlqtir hlrelii with Massachusetts with the result IDNDQN__.(CP)_ ‘There ls on! 
     
    
   
   
    
     ' - _ s dl ct lscend- b1: Will 
     
    

    
     on land with the ascending laps. That is the Senna. at the fmnl‘ Tl")? “"6 3C¢¢Pl¢d 35 ‘my new 5500900 miles; l“ m“ hemby home? ‘m mm the “level §‘.‘.l.‘21’°11?.‘°.";?f€ ciiionisitfl W119 svlitflaglitcetulifilngizltilii‘ iiolnlritf-iitloll 
     
     . . . Canadrans and d _ the figure Will be round about 11,- rank or Mac to be used 1. .. -- n“ . 
     
    

    
     cold, agonlzlng outlook. ’ ioidi-e" in the  dregariicd a.‘ “d? by 0H1" 000, miles. Regardless o! wee- and wherever he likes blltwileeliliiigl: 3,9,"; (35:11: iiimcitihlflihira. n coupon" n’ i‘ the Daimbiomll 
     
     , one,“ the Will's great fanacm" "75. Taylm’ French-Canadians Iflo dbiibbthlncludlng some  ililgserliiigngst ifriwvrfiffiiii ihhirilagebneeriliiiwciihen din the km a I Use Miami's for bites 
     
     1s the ldea that tlmc works for the Allies. It Canadians i-ii we'll-oi i H. iii" ‘Vere Jewlsh eases. important Persmnel. fllms. or Mnccohenfhnrtilerilii rointircpliirmi 
     
     docs not do so in .1 nlilitary sense. It does not do o" ° ‘g mid "Eimflllts. and written Mme; 5 
     
    
   
   
    
     , . - as ther ' ' ' - .. - 
     
    

    
     so m the 11111111; of lzuropc‘s conquered people. "it e ‘Vere m thefvindaor Fiotnsh "m!" Eltfiiinthldficrl°ii1nlisfffiiiislti 1QWL§PQ§Z1QL laoheh God knows it 1 sm with you 1f 
     
    

    
     1'9 r101 ¢11u11gl1 to say ‘all 1'11 good time.” he A _ use alter the war when en ines will oyhei-Qioumgegiisnii iliimdst °l ‘n’ to p ze' ' M’  
     
     .. -- propos our curfew law, environment 1' s do more i01- the some we gut, 11nd 3 l" imsfl- Those vlrtucs mod m4 r "m; 
     
    

    
     warns. 111111: rulls out. The great resources of gieaiei. cause of cii-m ii ii . s “din "id oiiiei devices wiii 0pm slon or the ruins o! oral House st b i D D ac 
     
    

    
     the United Sues. the abundant strength of the Frank A E e t an credllyl Judge up on era of safel tor commercial Pasuhmd l”- M ll" “me °l hi! Elli Dfiylfi 
     
    
   
   
    
     oo e . o 
     
     . _ Hamilton of the Jiiveiiiie Court flying which WW iiiivii seimed death he wore the purple and inyliiiiibut loved, but eminent P l 
     
     Allled Cillhfi, cannot rely on success through iVirmii-peg, mid the Canaiiian Penai Association.» impoiiibie iii iiiiice “mg _ Mm white ribbon of the Mllltsry gm" Mnrrspiggndsnmnta] 111,; 1; to d”, Q-s l  
     
    
   
   
    
           
     
    
   
   
    
       
     
    
   
   
    
        
     
    
   
   
    
     cdéfl 
     
    
   
   
    
     T0 A REPUBLICAN FRIEND, 1848 
     
    
   
   
    
       
     
        
     
        
     
    
   
   
    
     some ultilnntc victory. For if it takes too long it - _ . _ don pnbuclty, 5° ably corned at Merlcou 3' . 
     
    

    
     will not l1c a victory at all. The process 0f i=0‘ gae suiamltlteii. “After dealing “ml-l 0v“ 6°'°°° "—'— alga clireritislc illustration than m“ Si“! “rim 0521mm“ lopmsbfl“ “will, ‘i010: hamony 
     
     . . . . . . ses, mvo vmg almost any conceivable i e of The [reyhlus blankets now ma; olmd or the excellent will orillb moles. whom what glmdes, rlch sud warm 
     
    

    
     onomlc, lmmau, and splrltual hquldatlon, prcss- conduct iobiem b ii . YP o“, in m" manna. w“ wiiim spl t which prevalls in the l-ilgn- t ey o . i ion‘ “and 
     
    

    
     1mg m, (lisuhuioned peop], from Hump; to d i iPh "w": 0t children and and nutty. from 111s West Riding lwd Rcslments towards tnelr 1e1- "'01" l" 11m" 0i the illsi 1nd m °°°' ‘*3 ii _ 
     
    

    
     . . . uts. ave come to the conclugm (h t . or Yorkshire to the British Army 10w Canadian Jews nor u thl m" BYMIKFWWY ° Y 
     
     Gthrnllnr . . . . Will of ttsclf create the defeat vi- o i '1 ii m may we“ have iiiiieii the semi spirit "mmid i0 iii ‘iii ii ' (And for such doing they require dgo flatm- tho mt- 
     
    

    
     i- T] i n] i I ‘ - - i r "m0" QPPEHrs to have more to do \Vlll'l the 1 t 5 a" 5°51‘ not eyes); W°° . n‘; 
     
     o pcncc. 1c t1m1, 11.. t1e detcrmmatlon 0 cause of crime than heieiiii i ii. k . 0°“ l‘ 3' “Wm” existence. N“ men 8' I" ‘his w“ Jews “e "581" It’ sadness at the long heart~wsst uralbeauiy°fY°“"k"" '- f P-‘fil Fr 
     
        an   o- admitted t... . 11' t 1. l. * "1 l our other 11:.  §2l1"2‘{‘1i..“§1l"1.ll‘5““  were“ no ‘ . onmllulilll» 
     
     layed from 0111' rnvflll task at hand by the over- a l" l c" i5 Oftéll 3 physical iecied f1 g n Riga mm“ and 
     
    
   
   
    
        
     
    
   
   
    
     n: 
     
     from all over the world - wheml" "Irish? srcat ones an ' f? 
     
    
   
   
    
     _ _ - _ are hti sl .d with th lr 
     
     evaluation of our ultunate strength . . . Either or mental weakness which produce‘ a mlldcnc)’ "‘°m‘°“l' “““°"m‘- Pumwrs- °ld l°u°W cliildifihs o! otheer faiths.’ 
     
    
   
   
    
     disquie , 
     
     . . towards crime but it is the l1 ' 1 ‘ socks Sorting out these rass ls s 1 n lhwght" m‘ “m- "m" bdm 
     
     we hurry. cuhrr we do (‘M's task Wlil1 speed - ’ .. l’ Ymax °¢°“°m.'°' 11111hly specialised industry. r1111 ‘ffi; 3"’ 0° m ‘i’ 
     
     or more ii n“ iiwi in “min ' (siocvial and moral condltlons surroundmg the 1n- women and girls who do lt can Natlonaivilxetlteiliveflgiliévoi" The ‘W53?’ the home!“ 0nd N s 
     
     ________ mdual that produce the {cmlc s01! whkh is re- tell by a touch ll the rags cotLain w“ Mic“ Commiim ' 1r these are your; 1; @111, 1, mm HALIFAX. - ' 
     
     sponslble for most of the anti-social conduct we slloulhsfQciircipsi ‘zggciiili Canadian Jewish congr-Ess men Kiln im. ' _ 
     
     . . . ,, _, i 
     
     Sttll Pussyfoolmg call crime. mo”, 1mm m, wool “m, ,,,_ Montreal. May t. i iiiugcurs and whntyou feel, "in in m“ m, .1 an 
     
    
   
   
    
       
     
    
   
   
    
     u e e e twtiDust s mditirit are reénovcil his; "moved iii! 
     
     .. . . . . . _ , . o n ~ 1 i 
     
    

    
     Is .\l1-. k111i; st1ll trymg to fool 111s Quebec Cliiflda is falling behind 1n1ts contract to sup- ‘ uieflorovuesr 1n: rags ‘t; lulii-lcatc mgciig" is: ii i _ 
     
     fnllolvcrs on lllC co11scri|glion issue? Referring Pl)’ CF03! _Bfiiiil1 Willi 600,000,000 pounds of cliffigiieiflggeiiieifwiiifsgiiiiiigvmagi left over ulllll ihfilrvsliiihgwtiidf 
     
     to 'l‘11c-.~<1:1y".~ Lllvvrzll party caucus the Canadian 030°" during illfi i2 months starting from last teeth tears the rags lnto, wooily aififis. ifiififiiigifi “i5.il"‘lll° ml‘ 
     
     Picss iiiii: .l\\riiiii iiic Mime Aiiiiisiei. mid 11,5 Ocober, members of the Montreal packing and ilbm“ mu" Fm" "W" °" ‘he i l of! e er u dnitmzm 
     
    
   
   
    
     i _ . , and Ices to manure the hon 
     
     followers rcuuuns 11 clttlctls secret but one 1n- liV°5l°¢l< "idliilry Were told by Mr. A. A. 12.11“ vii; ‘1"f"1'1‘§w‘“s'2>=l’°fs“sl1'lu°§l1°, ""1"" °l 3°!" Ind the ordun-d; 
     
    
   
   
    
     -M|.tthew Arnold. 
     
    
   
   
    
     How Are 
     
    
   
   
    
         
     
       
     
        
     
        
     
    
   
   
    
     lire i '7' 
     
     Dlhnooe- I'll Iviwdldi‘; 
     
    
   
   
    
         
     
        
     
    
   
   
    
     . . .. - ' ‘ _ Barton, f t}, 13 o! scmerset. Even the oil an: arsp will" “d” 
     
     fo1mcd snllliccssnilll tonight that he had glven in! Bari o d eh atiiion Board, Ottawa. Mi" fglfihfi}? ,,‘§§I,’§“.1‘.’.{L trtrilfskxgsaigvlglefi a" "Wvefed and ut1|!ssq_ Nomi,‘ Your E es ( I amorous: u. “who. i. 
     
     sumncc t"lll.~l‘llplll>ll would not be necessary or Oil llrgc t _e 1n ustry, and farmers. to seek comm‘ blazers and “mum It i, is Wlsied. - Rcbzrt wuumson. u.‘ ‘mu n; service I‘ 
     
     5mm, iiiiic in mini,» every means of mcreasmg the supply of h0g3, as hard to believe that the stln, thlin ' ' "' n "n m h. 0 ' ‘wiimq, 
     
    

    
     Ho“ c1111hl .\l1. hmg or anyone else give sucll well as lmprovmg the quahty, so that the Dom. gilgfiigéoiijilgt: bffiliiigifljiiiiei“: ‘gilii u _ “m, m.‘ 
     
    
   
   
    
     nfistlrrlncv? lltlw dot-s l1c know what rcinforce- lllion may catch up on the bacon shipments over- thick pile. It is first rcured in s 
     
    
   
   
    
            
     
        
     
    
   
   
    
       
     
       
     
    
   
   
    
     _  _ .i . , i ' specialist. bynrudcsdl” 
     
     mcnt. l.111.11l1.\11 forces morscns may need seas and iilciable to complete the scheduled com- §$,";i*,j‘,’,’§i§"{{},§1‘,“ftfi‘?,i{l,if,'3iflifl M "i “M” ‘mi m" was! and his!!! 
     
     wl11-11 they go 111111 .-1ct1o11, wl11cl1 may be at any mltment c ore next October rolls around. it requlred. After Q thorough wad-ling g; "$.13," m; . “m... i h‘ ‘hi’; 
     
    

    
     iimi. _= was pointed out that in the year ending with last "i"??? Wxlfifinllf CM?  Pflssgg retracting union. e nu u vousm 
     
     “.\l_v K4119." ~:t_\'~ _l|'1c (':111nd1;111 Press, "lcft the October Canada had undertaken to suppy 425,- dried‘! Afm, fliiliitg‘; émliflofiks Oil! in uni Gisela an l-OOIQIJI In” Mo Wm 
     
     ;,-111¢1|. ul1:1111.'11-r s1111l111g 111111 apparently happy‘. 000.000 Pounds of bacon to Great Britain, and 01°" like l "mil"? 1W1!" Pl-i- ‘whim.’ faults (221.3. AW“ 
     
    
   
   
    
       
     
    
   
   
    
         
     
       
     
    
   
   
    
     llc said ‘rh 1211' :15 l .1111 cnnccrllctl it couldn't llad actually shipped that quantity. Then the re- #1,,,‘,‘"°"’“hl““ brushing" “ti,” 
     
    
   
   
    
     I . h 
     
     haw- hr: 11 llvlfvy- r-nuvus,’ ’ quest was made for a larger quantlfy this year, dreds of tiny wire hooks that otaw 
     
     H111 <11 1111- ns (‘:111.-11l.-1 is conccrnctl. and our rind Canada agreed to supply the 600,000,000 ‘l m‘ “hr” “d 9"“ "m" “p l° 
     
    
   
   
    
     . or book n or some: Ill’ 
     
     timer. I'M 17°00 gun“ 
     
     scum. N- - 
     
    
   
   
    
       
     
        
     
    
   
   
    
       
     
    
   
   
    
     6.1’. llutcheson 
     
    
   
   
    
                
     
    
   
   
    
        
     
    
   
   
    
     i 
     
     TIIE TWO INS 
     
    
   
   
    
     _ ,. . . , V th- "bl nk t" f l S: l i 
     
     ~ ‘h: -- -1\-<-r<<1.1<? llmt 1s :1 more unporlnnt con- ifltrll requested. Sn far 1n the current year 350.- Enyetilin; is 13st ‘in fir? wholeartgsoi-Y F‘ o‘ “noun” 
     
     ' tellwn, thw- u-1111d<~1-< Imu- for. if at all, 1t en- 000.000 [wounds have been provided toward the  g{,,,d'}‘§d"“,'§§§§"Ii 1.‘§‘,"1§'§~o§§ u‘ " "no-nu". Ill Greet 000m lined 
     
     11-111 lulu his calvulauons. _ 0°<h000,<>00 obtectlve, said Mr. Barton. cunost u 1111c 1111, The 1m” £11m;