Friday of Saturday Only suus $34.95 -- TOPCOATS $15.95‘ 100 Suits Go On Sale At This One Pride Men, don‘! Pole up this opportunity - We won't tell you what the original prices were-come in and sci Finds Germans iiot ilonvcrtod Tc Democracy y. Here's, Bargains Thai: Will Knoclt . You Over MIIITIOAIWI! SIREN. All! I—(R0ulerel— three out of W!!! 101i!‘ Gifllklil u: the Bltisb aonehave failed to oe-"ccavertsd to democracy and have little or no deith in the host of deucaatisypartiee which have sprung lib since the end of the war, according to a. spokesman oi the British control. commission political division. The average working German mm and wornen cares about no- thing but the food clothing and coal ltustiou. the spokesmen add- ed. when an election comes along. he votes ice this or that party. but oniyboceuee he wee taught under the Nlli roll-me that it wee hlsdutytovotoandnot because he has any reel interest in party politics. "Generally speaking. We olll Ill’ that our attempts to instill democ- racy into the 90°91! 01 WBW" Gorcns-ny have been mainly a fall- ure." he continued. “Nowhere is there the some am- ount of lnterest that one encount- ers in Britain, and nowhere is there any rcal understanding s- mong the common people of what the various parties stand for." The spokesman felt at the fallureoftheflarmonsto takelill democracy in a big way weo duo to three main afctors: l. The moral and spiritual col- lapse in i045 which loft the people half-stunned. disillusioned and ill- inclinod to take part in any “new experiment.” The collapse left them with a ruined country, one of the enost acute food crises known to pres- ent-doy Europe. and an over- whelming feeling that they had become tho ‘untouchables’ of the viz»- lu 5% for yourself and you'll roolly he surprised-Worsteds and Twecds in single and double breasted models- Choose frcln llues, Greys ond lrowns. Sizes 36-44. ' TOPCOATS —— $15.95 CHOOSE YOUR OWN WAY TO PAY CASH-é CHARG! on yoar regular Monthly Account. ‘A Dowa-LAYAWAY Balance In 2 Weeks. MQDRE g, M1599 imilecl ONLY 2O COATS IN ALL-BUT-they are 2O bargains for the right men.- Browns, Blues and Greys-broken sizes of 36-42. NOTE — This Sale; Does Not Begin Until Friday Morning See Our Window Display l hydro-electric plant llalckies ggd? "l'm sorry, but we used tho and now they're all gone!" SWEDISH HYDRO PLANT MDOKHOLM, - (OP) A capable of generating 200,000 kllotvnits ls to be erected on the Ume River at By lion Reynolds ca s / Guardian Want Ad yesterday- the most northerly Zip of Sweden. Authorities expect the plant will have been completed and dammed back a giant reservoir of water by 19.55. l area's-luau (qr n sums- mu" nssm Cqecoleilukeverloaaeellaearhslvepeeeel dad "fevladnmfiliy/‘h-layeeaeshieeka eellcveertqyeenaleiecsweyeeteweperlerlee euh Irebeaemh Iaehasemh Mo. 5 iNiZET (T I (I < f“. \»'"I y. I 150 HOUSES FOR. SHILO BY WINTER The Canadian Army expects to have 150 permanent houses ready Ior occupancy by married soldiers at shllo, Man, by the fall, the Bnllo Observer reported this week. The houses will be complete wlth basements and coal-burning furn- aces and equipped with electric stoves and refrigerators. Approximately so of the houses will be concrete block duplexes and 60 of frame design with priv- ate entrances. They will be dlv- ided vertically so that each fam- lly will have a main floor and an upstairs with a total of six rooms. Ono interesting feature in the construction of the houses ls that all will have windows and doors of standard Army size. This will en- able families moving to married quarters in another locality to use their same curtains and fix- tures. ~ ' It ls expected that the Royal Canadian Engineers will have tho project under way by mid-May. 4 NEW EGG BATH ADELAIDE. Australia — (C-P) —A machine which cleans and Plitcurlzes eggs in the shell at tho rate of 18,000 an hour is being used, v an egg exporting firrrn hu-o. I ls claimed to be the only PUP/XL hine of its klnd ln the world. The eggs are fed lnto a bath at no degrees Fahrenheit. where they are scrubbed and then pass- ed lnto a cold alr chamber. Skilled Bushman Guido Scientists lntc Arnhem Land By LESLIE BRODIE Canadian Press C... SYDNEY, Australia. April 28 - (c?) _ The United Slates-Austral’- lan scientific c _ tlon now in Arnhem Land, No Australia. to probe the mysteries’ of the Austral- ian aborigines in their natural sur- roundings, are to be guided by ex- perienced “bushmcn" of the North- ern Territory. A number of these men have been enlisted by the Native Af- fairs Department to act as guides for the expedition. They know as much of the land as any white man, and are respected - and ln some cases feared -by the na- tlves. The expedition is sponsored by the Smithsonian Institution at Washington, the (U. S.) National Geographic society and the Aus- tralian government. Charles P. Mountford of the Adelaide Museum is leading thecxpcdltlon. Mountford has established a transit camp eight miles from Dar- win, and the first base wll: be set up on Groom Eylandt in the Gull of Carpenter-la. Journeys from this base will be guided by Fred Grye a former trepang fisherman who has lived many yrears ln the area and knows the nutlve dialects yrll. In 1934 he helped stop a minor war between the natives and whlfc men when he persuaded the no- torious Caledan Bay trlbesmcn to meet the whlto men for a. peace conference. He guided the police party that went out to search for the trlbesmen after they had mu;- dered s Constable McCall of the Northern Territory Mounted Police. McColl was investigating the mas- sacre of a number of Japanese trepang and pearl fishermen whirl he was murdered. Used Smoke Slgnela . Grey used the traditional mos- ssge stick and smoke signals of the natives to contact tho wanted men. _ The Grootc ltylsndt natives have the finest physique of all the Arn- hem Lcnd natives. They ere a u-cschercus and ferocious tribe and will go on the warpath slightest provocation. Grey's know- ledge of their habits will be of great assistance to the scientists. When the expedition moves fur- ther inland. Gordon Bweeney of the native affairs branch will take over from ‘Grey. Sweeney has spent do years in the Northern ‘Territory and is said ts be the first white men to move in as fer es the Kavelock Fells on the edge of the yast, mysterious escarp- ment of Arnhem Lend propcn. The Royal Australian Air Force will fly all men and eouivmm bo- tween bases. Deputy-leader Dr. Frank Betzlor. chief curator of the department of Eclipse 0f Sun This Ycar_ To lie 0f Military Value By Howard W. Blekcslce ‘ "‘Prees"' Editor NEW YORK, April 28 —(AP) -- Tbc first eclipse of the sun to have military value since the one that stopped a war in 565 B. 0.. lslses place in the Pacific Ocean May 8. This eclipse will produce means for more accurate shooting o'f guid- ed missiles and of ocean-spanning rockets. . ' 1n 586 the eclipse took place in Eastern Anatolia during a battle between Lydlens and Medea. The announced purposopf the May 8 eclipse observations, as told by the National Geographic Society. sponsoring the expeditions, and popular astronomy. is more accur- ately to determine the shape of the ll; the 1 earth and better to locate any da- sired point on the globc's surface. At present such location is donc with errors ranging from several hundred feet to one mile. ft ls hoped to reduce these errors to not more than 150 feet. For military purposes, a calculi. tfon error of one mile in location of a. distant target, is an added aggravation in a problem already near the limit of solution. A mile miss may not seem much in a 3,010- mile shat. but it is a good cr:or to get rid of. Even a present-size atomic bomb could lose much ef- fectiveness by a mile miss. The astronomical observations will be made from seven stations along the path of the eclipse. The start is in Burma, whore the eclipse first shows, the end of the track in the Aleutian Islands. 5.830 miles away. five hours later and one calendar day earlier. The shadow starts on May ll but crosses the international ctlmc acne to finish May t. ' All stations will time the moment when the edge of the moon ap- pears to touch the face of the sun, and again when the edge of one leaves the edge of the other as the eclipse ends. The May 8 eclipse is not total, but annular, meaning the sun shows a ring of fire all around the moon. The moan will be too far away to completely hide the sun's ace. Museum, hopes to establish th‘ “time sequence" of the netlv . xi told a reporter that tho scientists expectedm find that the fools the Arnhem Lend natives use today eao the ssrne type ae their fore- fathers used woo been m n ‘ o ““.mn“ r- be necessary for from know now and were Dr. Ietsior said the Aaewslisn eborieinee an e mysterious greu without trace of the ceeraeierla. ilce or the ltoasolian or groups. lome Ill thropology at the U. S, National prlrrritlve whlio melt.’ Pouliot Takes Two Western Papers To Task O'I'I‘AWA. April lo-wfi-Jcau Francois Poullot (1nd. ln-Tonue- cuusta.) in the C yesterday criticized the Winnipeg Free Rees and the Vancouver News-Herald for their editorial comments on e speech he mode last. April l2 on human rights and fundamental freedoms. 1n his commons speech that day he put on record a. list at names of persona who supported s petit- ion calling for a Canadian bill‘ of rights. J-le sold wucy he hld not described the signatories as "dorm munlat dupes." But he wished to do so now. The list included ‘the names of e number of preeminent Canadians. Mr. Pouliot quoted the Free Press as saying: “After reading what the; l, ilovo they are developed m”. . Mr. Pouliovs speech in the House ad Commons we are almost ready to Join the Montreal Btsr in its current crusade to protect liberty by abrldglng it...for if the Quo- bcc member is right, this country ls indeed rotten with Communism. and not only this country but this newspaper." Mr. Pouliot continued: -"Thot newspaper may be, but 1 never said the country was; l nev- cr used that expression. l protest strongly against these phsrisecs, those hypocrites, men without any sincerity who are ready to protect Tun Buck and all the subversive elements in the country but al- wesu have insults for those who abide by the law." (Tim Buck is national leader o! the Labor-Progressive Party.) Mr. Pouliot said the flowed-Ter- eld referred to him "as another in the House's lunatic fringe." The newspaper had described Nov-- I. G. Eansoll (SO-Muted). Norman deduce (UO-Westeakiwin) andhlp- sol! as "three craokpots" and “the three nut M. Pa". “That paper" (the News-Herold) said Mr. Poullct, “hes no ofllcial representative in the press gallery but I understand that this was sent by the nigler in the woodolle. the poevieb and ranocsous boar» black cl the right honorable.” He did not elaborate. western world. . Busy Keeping Alive Between searching for food, clo- thing and fuel. they bad neither .110 time nor the inclination to take any interest in s. "democratic awakening." 2. The ingrained German "fuch- rer irtstlnct," that. is to say, the desire to be led and to leave tho government of the country to "the men who know how." This instinct, already discernible in the Middle Ages. became dom- inant in the days ofvBlsmsr-k, and reached its peak under Hitler, Goebbels and the Gestapo. "A nation which has done what it has been told for generations can hardly be expected to adopt Ilemocratlc feelings overnight," the spokesmen declared. "The German tendency to obey the government of the day remains and is perhaps responsible for the fact that the Germans have been so quiet and docile during the put three years." S. Probably the most important of all, the shortage o! leaders of democratic thought who are really abreast o! events and ‘ ndcncles abroad. "In 12 years o! Nanllsrn, the young men who would normally have cm ‘ as democratic lead- ers either rotted in concentration cernps or became prominent in the Nazi movement," the spokesman said. “Those who were in concentr- tlon camps returned three years ago out of touch with the modern world and its .way of life. while those who became Nazis obviously would have no place in. a demo- cratic revival. “As e result, tho men who took over tho leadership of Germany in i045 were the old-time politicians who were in their prime, in the time of tho Woimar Republic, and are still mentally living in the days following the First World War." NEW CULINARY TEKJILVIQUI LONDON - (OP) - A catering firm hero cooks en entire meal and than frecsea it lo that it cu be kepg indefinitely and be heated and served on short notice. l‘. ls celled the “frood" technique. GET 'I.‘M FIE!!! flesh stains are easier he re- move than old ones. If tho table cloth has been stained during the meal remove tho stains before you start the dishes. the cosmos annoy-no of black flies, mosquitoes, gnarl and other insects. Tenioo keep! them away $6 hours . I . prcml sunburn . . . aids natural no. - s REPELLENT CREAM llofd. trade-lull l“r’-’(’ f/idf/r’ I ml“ i... ‘ oiverss ee or other glftoecell s!’ ' lIllIlI-‘llll Sfilll Phil Ail OOGIOIOII... i Bridal Wreath. loag (school ll ' rnak oflllllu °..‘.".i.‘:'..'::t':.‘ will» and! else jewellers’!!! v M for birthdays. as: rice for villain - t c; l Jewellers for Four Gencratios