sEN

AGINI-‘El. John

f’ ammuusrhfi u

PRIN

GUARDIAN

m

"We lust-Phone lee-r

ltroot arm runes coum-y

[miner-slid : —

Water It. Toronto Bakery. Water BL

of local interest hut advertising of a news! nature may belnae

e4 gt 2 conic a word strlely pay-

able in advance.

_lllGll Protein Concentrated

reed for wws, horses, calves, pigs ‘m1 poultry in shock at Bruce's,

L- 1310-3-23-2).

_.WHEN IN need of feed for livestock see Pond and Delaney, gummcrslcle. They have feed for every need, L-1295-3-22-4i.

-Bl-I SURE to attend the Auc- tion stile of stock and iarin imple- merits on the farm of W. N. Jenk- ins, lower Bcdeque on Tuesda . March 28th, L-1372-3-25- .

-W. N. JENKINS splendid herd of Jersey Cattle will be sold to the highest bidder at the sale on Tue..- dav. March 28th l P. M. at h s

a f t Lowe Be ue. m“ B‘ t elixir-Mimi

-WE HAVE a complete stock of feed. for foxes. poultry, horses and cattle, at lowest prices. Pond and Deiliney. Wholesale and Rcaii, dealers, Summerside.

L 1313-3-23-26-28-30-4.

—FUNER.AL NOTICE- ‘Hie funeral of Mrs. Elizabeth Jack will be held from the United Jhurcil, Oenterville. Bedeque. Mon- rlay at 2 P. M. Ilitennent at Low- I: “ Cemetery.

-PROBATE COURT — Hon. H. i. Palmer. Probate Judge. was in Builimersido on Thursday and held a session of his Court at the Town Hall. The estate; oi the late Jos~ aph Higgins, Kenaington, and Ches- icy W. Howatt oi Tryon, had the accounts posed and the estates were finally closed. Heath Strong Lppehffll for the executors. B.

-ALL SUPPLIES used in our $2.96 special perinanents guaran- teed genuine oil i - ly for this particular time o! year. wheriyoirrheirisds-yandlifo- lea. mquirc from operators about our special vapor ..... ‘ machine- leas permanent. Noonank Beauty Parlor, aummeaslde.

lrilill-S-fl-lll.

-ADDRESSES Y’S MEN'S CLUB -Mr. A. s. MacKay was the guest speaker at the regular Wfiklhfilw- m; meeting of the Summers _ s

en's Club, which was held in the Baptist Hall on Thursday evening. Mr. MaeKay 380KB on Bummer!) a; past, presen and future. His ad-

ess was instructive and full of historic meaning. A vote of (hanks 3d; miicnded to him for his a len-

d address. The ladies of the n- t t Auxiliary served a. very dainty I ppen-S.

—DOUBLEIIEADER hockey at Kensingtcn, Monday. March 3'1- First game ommencing at 7:30. Summerside Crystai~ sisters ve- New Annan sisters. Second some Margate vs. Clifton, second game oi the best two of three total game series for the Campbell Trophy-Admission 10 and 30

is Ia-IMILS-Iii-Zi.

-—RETURNED FROM SUSSEX. . B.-Mr. and MN. R. A. Pmfitt Freetown have just returned from visit usse N. 3., where they

Ho ein cattle. Mr.

' Proiitt who h President of the P. u. i. central Farmers Institute has Won many prises at Amherst Win fer Fair and 5.180 at Toronto with his splendid herd bi nblmins-s.

Personals

-‘!t is pleasing to report that Mrs Bruce Currie of Elanadele is imwm" ihB from her recent illness. 5-

~Mrs. Wm. Graham has return- ed to her home in Coniway from the Prince County Hospital where she has been undergoing treatment. S

. Horace Carin of Moors

Mills. N. 3.. is n visitor to NW London. where he attended the funeral of his father, the late John “' ‘wit? Etitmtiii‘ “"3".

. v . Belle, who lsill at heshoenc Graham's Road.

Auction Sale

n‘ wives: nus-tune

Bnvlnfi flapooufl of flfllle I vlll aell y public auctions:

TUESDAY, MAIDH 28th i - Iellnnllll’ It 1 P. H.

euaeutl. flu». WI-

Thongluardgn will. be dlualverod m carrier Y l W! y or oer week. Ph . ‘iv; your order to the boy responsible for delta}: cllnhyou you“,

-Thls column is reserved for nawa

“r Schedule

T umsabaslsunanuvuuungmuiabbiuowiihurareua?’ T} The Guardhuusayboboughtdallyutauy of the following mm};

Gou: p u) who-ht: s? uY-fiitlilfin. u’ "l! Mlle Suaumorulda by I’ this aervlco or

—STOB.K LATE 35c at Taylor Drugrcfipiggfsgigtzg

—FOB. RENT_1_m-8° b“... mm“) “"1"! 01110418. professional °' "Wow purposes. Dalton Build- ine, Bummerside. L-1345-3-24-3i.

4mm our. ,

1,3,1, egg-e WW5. §<>§3°“.'i§’5‘d'l§i§it€§ [or d r than Bran for cows be- l B H11 alter lrcsheni . Priced °W "- Bme-S- L-i io-a-zo-zi.

—GAVE SUPPER

gill Cannon entertnieigcillligmmae ub on Thursday evening gt g.

"PM? bridge oi three tables-S,

'-ENTERTAIN GUILD-Mia. A. W. beard was hostess on Friday evening for the Ladies Guild o! mo Baptist Church. A most enjoyable even“): we! spent and at the con- clusion of the evening hospitality was dispensed the hoates, as-

, by some o the ladies pres-

Crystals Win) From Unions

At Bedeque

Bummerside Crystak, competi- tors in the Island Senior Hockey Ikflfluc, last night defeated the Victoria Ukons. Maritime inter- mediate Champions, in the Bede- (lue Rink 9-7.

'11"! Bflme wiis fast alid hard fought providing plenty or exgm. nilalt; for the large crowd oi’ spee-

‘SUMMARY First Period l. _1S7'Slde, J. Hogan (Sohurman)

2. gSégide, Brimble (c. Hogan), ' o_ Coml-Ibell 1:20. Steele 12:30.

_ (Csliill, a. vibwria. 11 m... 11:40. ‘l- Victoria. 0- vbmpbeii 19:50.

Penalties: Rankine, Taylor. Second Period

8. Sflide. Cshili (Hogan) 9:55. 9-1 lihgitie, C. Gallant (Didrie) 1o. Victorll o. CB-mpbe ; . ll. S’Side, Bchurmann légghill, Hogan) 14:40 l2. S’Side, Schumann (Oahlll. Hogan) 18:15. Penal/ties: C. Hogan, Rankine. McLeod

rail-a Period la-wsggidv- 0- HOEHn (Gallant)

14. vléwiiu, o. cuupbeii 14:50. l5. Victoria. J. Knott (L. Mm 161.0%) 16:50.

. owrl O. Campbell (L. McLeod) 19280. Penalties: Brimble.

Lgefereos: Earl Arsenault. Orilly

Weekend Hockey

(By The Canadian Press) Stanley Cup Playdowua '1' vv (Sunday) Series “M:- Rangera at Boston. (‘Ihirid of

besbof-seven games series. Boa- ton won two). Series “C":

Canadians at Detroit. (‘Third of best-of-three game; series. Each

won one). Allan Cup Playdowna

Tonight (Saturday) East:- Interpiovinclal-Balnt John at Hull. (Fourth of bmt-of-flve games series. Saint John leads two gsines to one). Weak- Western semi-iinal-Port Arthur at Saskatoon. (Second of best-of- three games series. Port Arthur won first).

Western seml-flnal-Klmberly vs Lethbridgo at Calgary. (Third of beat-of-ilve games aeriea. Kimber- ley woréutwoizbyd All“ p owna

Tomorrow (Sunday) last:-

Quebec . Final-St. Jerome at Montreal Royals. (Second of best- of-five games . won first). lluuortsl Cu Ilayillflll

" Tonight (saeunuv) last:-

Inuu-piovinoial — Perth Blue Wines at Charlottetown. (‘mini of bsat-of-ghree cameo eerie!- ncll won one .

Quebec Final-Quebec at Vor- dun‘. mfleobhd of two-cam tai-

a ea. wantario Final-Oshawa vs North

To to. (First of beat-of- ,“ ‘t mules-lea). ~

Western Sami-finol-llocao Jaw u. . (Third of beat-of- ao) games serial. Edmonton won

Waahrn leani-finai-Bnndou vs llbrt William at» Winnillel- (BN- oad cl boabof-tlnoe games eel-lea. Brendon won first).

niwsram eunuauuu. unis wm n o. March a4 - (om-v: Iwhlpheraon. u. manaus

‘Witter.

C! d!‘

- ...... ... _ ..i_. .-..-.- -a--<-

TILLIE me‘ roller. -- A New emu-Lennon. 1'9 SAY THE

\

CE COUNTY CHR

LOOK A LOT CUTIR THAN THEY D9 NOV¢I$~ LOOK AT THE

LINES OF‘ IT g.

1| ii-ue Ir

1Q

IO

BY rovi-z, muss, us

YOU'RE RIGHT, BK.~MISS T MB HAVE THAT F ROCK TO DUPLICATE AND YOU

By “lestover

LISTEN~YOU 705T‘ DISPLAY THAT DRESS \N THE WINDO n I

YOUS

w mo m. ear ELL FIFTY .

i w? ~ - .‘-.~.-<~¥bw-.-......:.'..."- r“ -- "'7 “~"1‘.‘-7<Y'"*-:~\.<xF¢§*Qii5h>'JZ-t‘r

.-»_.»~_;.~_.. A...“ L‘; .,,,,¢_;.,,,..,.. ,,_,7__\_____

-¢~..=-.l<.~.»-e-

was are _

..._;. .. __ - -..,..,.. , 9g; . ..,.

. -- w." Fascist Guido. Moves to Fore Pu blzc Accounts s“""" ' ' ‘gain a“ “m” Emmi)“ liommemo , ,,, ,.,, ,,..... , . . s | V‘ ‘t ’ . PRAGUE IMIQ I1 - ‘DIHIO Anuaunaut ‘n: 11 you: ago Golda stood i!) "who ‘h! mm: _-- kwmmwfluotuhjifenguluwfimobehg (J) Succession mtiea 01,102.40 mseue musicians nlsclunl 1 I-ud ‘I Mimi'- d0- -_-_ grunge’)! nun/tn orrawa, mach 24 A0125 31$‘ blmgbbmubuon la a l-l-Ivmslsrlummam anawuieu- wlllbu unbi- ianaoilatQuebec ynwiththenflvfltmoviof (A, V“; was?" carefully new b! m“. M1015 w begin their ibuv of the Ado]! mm u» complete iii-unem- . .0“ “NHL?! m; mum“, '5, '1“ u. , poet oiifice employees hermem, of the little lie the (B) Fed] License; again u‘ 340.00 melanin-Mg “kw; fromooasttocoastwilll ace minamaofcaldais in (C) Prothoudary Rel 151005 h", u,“ “ma, f" u‘ u, sheets oi’ new postage the streets and there is indication (D) County Court no; {M9113 w, 9,5,; “pl-gum; m‘ ily issued to oom- that he may rel/inn to power to (z) um Tm‘ ‘m mam,’ ___; ' h, “flaw. . ‘m "may. memorata the Royal .visit reverse the vordé: of i922. d“ ' 011m" n! 1 0,867.00 Mud‘ “u” m. 3' mswmda-genlfilcofimiemorutizilre in gzebhlostativakits fa: (F) Bu“ "WW 44500 Guam’ n’ N” ' atanrps wouldybe of one, two an more ironic than that of this mad (G) Seasional and Illumination llbea I ‘mu nwumhu” ‘m b‘ cents denomination. They Noir is there o, story more colorful. Prince o! Wu-liea College 810145 ‘- h d" h“ m " will be available art all post offices Golda, was a Moravian peasant (n) Brok mi aghg-ign 2,9660 “of: firs")! i)‘ "In"? until the supply is exhausted. farmer's boy. But early m) leis m mm" "WWW- vio wit!) swoon-v. Male an sivmlui- m nundm gguivlialberlgsumg “m: ghepréfie wnnliiwolfigui“ that its. (J) Merriam Act l 1,858.50 "'1" I" W m“ WI arvenaa tyhe information wand be pfilnged lbw the great war as l (K) Vita-i Btariiistia 819.73 improperly available to philatelic soldier of the Austro- (L) Dmnmm ma’ i i‘ moo a e a eta. ‘Ilhe royalty stamps army. But his all to the (M ' _ will be collectors twins and the Austrians was s art-lived for )Privaio Bills 195m, noosrs run cuAnm G d with chmuwm d _ (u) puny yo,“ 290230 Como in or phone our llard- Klee of stamp markets would soon Sea)”: m me Semi cm M T: (o) - - n" Den-nu“; (o, . w“ fixed if the total number were an ca o - Fialcon-wood Hospital and d “m”. Th“ mm“.- . known and iihe public mtg/ht have over, he took hundreds of his Aus- m! W. 9-4359’ clever booklet allowing in- “tummy buying “an” v m“ cmnmmoh with mm‘ (P) Wholesale Oil and Gas ' dlviiluul color echoing 5, The one-cent stamp will be mmbuim i.ooo.oo loo 22.83 Betty Moore. a manual and M” ‘m "“‘* m“ “IN” MUG“ e9 mm boom, u“, w,“ ‘m with.) ggetPrincessier‘ AND sranvun - Rose. 4. mums-runner: orrnonmmon ACT 58,0194); Y" “"1" "f 0"" "W stamp will be brown §nd ob-iifik He was with _thcm in uieu- n- 5. Flnca and Penlltlsa 1623A! for your Illflng painting. ‘my, 5 pwtme o; the National mo“; retgggfl Albgnlg, 6. Sale and Rental of Sundry Coanuroditicu 3'03; 31 ' 1‘ " War Memorial to be unveiled here wallowing in the mud, starving ‘l. OTHER, Rxvgmygg ‘ PM! TUB! Ulmcxmfl- ivy the King May l8 The three- Ho went to Corfu. After that he AND REFUNDS u!“ I an“ with (A) Pm“ “w” ‘ 115°“) mm‘ h "w ma!“ “b” cm tsmpf “Knirigmve fun-face gtlildnietu ti‘ a part General Guide. ow (B) Old Age and nuudrnbslbu re- {if ‘ "°° °h°°" ‘m “m” w Eligabeth nnuqviligie “£3 lnethe epic mud-db across slim-la r? ~ ’ r funds noln other Provides 086.01 ....'L'°,.,'.'§""',,‘{'.','; 11'1"’ Q2" and black. a-nd emerged s; full-fledged aen- mo. would mi also! 4‘ 1 g (G) DQPWHmQnt of sol-indium 3,017.46 Q1100 In yin]! radloereoeptlorri. 1m "hm Item" W111 l" double - i" s (D) Department o1 mime Wm.“ 91M we “I, “m,” my ‘n, size. slightly wider than they are Fmm that day tho star (amino i m) cuualmvenu ma“ "Mo “be "on m", h," high. Tgzlgorder will be the same azjgambulréited -. AND NOW .. ¢_,.ev (F) T“ Oollwwmevsoense Amimt 1,560.08 m‘- °'“ i" “hr Lin”... no gyecfiatluxjvygeijkiriirgldtolhfi gublic, Coeoheo-glovehn 5611C him no umoiooaii ‘_ (G) Grass Seed Refunds 1.14 5,831.04 H a Nys Ixiéwaifw they mark the visit o: téot tiéi; Frfinohvm qmc schoolflgl: Golds. as i? Y . . X‘. 6 Homo i! I - 'mrrnd,ommmymvmw_____ dniluponnisietumtorrbguewas ongdnyumeohiluacistpfl-‘IWQ 81.894.184.00 S .d made chief of staff. born and Golda was on his will“ CAPITAL nzvusue ummersl e Outsidef Stlxhhnege ‘tviilxilflgshaethefi. Elia’ “M936. Enter? nsnnums w.“ 1. LEGISLATION General GaJda and so he was not quick in wt back in 19W 5_'n°m1"1" (B) Government Hous* Jecta 15,312.87 T * h long in his office as chief of staff aoarcel before d‘ Contribution» sewn-ti iifimfi Efmm‘ " "‘ 14”“ 3m§§$§iT M M1‘ 463023 "umP S In wlvtkligefioffiétiiféitoi thehéxgs-oh m...“ This uniform. Refund from [fishermen (D) [émgwia figmly IQYHM gugrgued fljgh- ' ' , lcgionnaires? Was he not The bid from the army and ordered hit: and Fishermena Unions 213N314 (E) Provincial Audlgr-s ' ' ways-Qavinq w $iil"1.1130.(l))0 golinsgfilthlsemilrgfllkvfitislgnwlflmthg: mmmmw ""5 some: 0m“ ‘$33-55 sud GM M’ ° fl: politics bi the new Ozeohmflio- vi-nbiioiny all of Work Aid holeots-Doln. 102130710 -_-__ vakio. between the dam ‘ta and vakiq, upplaiaded that notion Contribution 30,510.44 “has!” ' ' ' A1N'I'R.EE_ Englgnd Mum 24_ the rnkbibikr the sullen Golds went down Tourist Roads Projscts- G ‘Gm w Tmmst m“! _ (CPl-Workmnn, Sir Alexander Well, why not make dmgraoe. The whole of Dom. Contributions 40,000.00 ' mmnnm 38,5,“ 1023142., Me-xuirezs sturdy jumper, today of a new state. aside ,. ‘ ’ it as well as a. ' you“, 111mm‘ new,“ . (A) Field Supervision t 0.64331 1,, Nation“ Puk_pur_ ~ ~ sprang from behind in the rind] all differenoa? After all, de- v- f . -Dom, contribution 1335053 (B). “W591”! 3i Willi-Ky’ £620.79 ab“ o‘, m“ mo“ M mile of the ioist runnln of the moeracies were failing on every Bin-ope. of course. could Eumlmtmn o! Maw“ (C) Grunt; to Farmers m Tommi m “on - ~ sGcgandthNatlonal Steep echase to hand. Would it notbe a. ma-ttero! toraee the sweep o! Hitler‘: _ Orooslnob4tailway Con- 1 731.50 Banding Pmkctflfimmflu bizremeséirstvictor in lthe time until even the new Czech bitioris. t gun“, 1m u“ "33 ((1-0)) nizairylnp-fiunpjpigogr 366.53 N B . . In," m 19m 0e wn t. ump ed 5”“ 33"“- " ' 10 Bmvlrwial Contribu- ' ' Cornered in the pack starting a a Refunds on Seed cmin l2 out "will" m" ' ih nndl - S lflfifdlltafltc" on gum, '° (r) Elgiligitiorlswdliive- “mm tlonsw mimielou relief “M” §;.,,j,g,,.,gg'>,%g gngkjpilgfigfifl‘; Byron Nelggn lmmermgs m“ ~ .. “m!” m) Bchooal iii-tn. all-mu. *°- "dig?" 1mm,“ 0111 son b‘: it’; cfiinge-déiylillrii, - d rum “m... QJWMqT-‘g, (n) wouldn't rnbumtq arouse “Mm WMIM- - - made his bid 111512 where he falter- Wins Tourney ATOU“ Q . 1936mm“ m ammo) go mo“ iinooa G51“) “M” gm?“ agmome aiiccli $3“ ‘w: - Increase in liabilities lawsuits if’? n", i“ ; finfgfififi? learn-is Tbvgml“ gig,“ MMMMI“ Front “i Cont“, 3,145“ 23. Youth ‘Training Pro- Kllltfll‘. Dorothy Pageils B to i (By The Aloolotol Peon) - ‘ ‘ 88.608.604.42 (K) Foxehfihmtlm‘ jects 27,940.50 gyvolrétiiknvéagsihiréfiixn thanrleid g: , u. 0., oral-ch as- ..._-_ ._ olmmanu uxruivnrruns Tggiilw. eigime ggigafgé “- mbmil" “WWW” N434” algnderel-li four edfenoes Ifbnfnhflmg gaps-Ruled (u rm- sear: w) ‘ ' 0 A8116 . . crow settl d f d l _ I B . 34 m’ ‘he W" "KM 81st Dwmber. ——- “M504” "°‘“°°“ ‘m’ 1°° mogmshgé ‘ii/it'll: ggyviirlmiflieooofl- o lumen y: NEW m»: a( ‘I222; “dml” srauulvium or manrnrrms 9m§iw§§nFh° a” t” 1 “Md”- South oven sol! tournament h hum at tin-nib}; a quick (ma: 1, D531 c3533“ 1. Tourist PNIIIIHUMI 340388-29 grog minded Deb a m 00°00 wihkirag thethieed ether half- tags” gfiegYol-Kleadlng’ ,;,_,",,,,‘Z gasohyezraewa h.” i, 95409 (A) Intel-eat db Deban- 3- "ilhflyl- 5M8"- w, sinking mud _' ' ' KER fifiMof,at'a§nsjdewof§,,§he tied of! four consecutive rounds of bet iih' his Tun-bum tum. loans and Bank “"11”- °'°- vesilmentfl incomes 700k the fences like a pail‘ of snfit ‘(1-68-70-"(1-180 M1 the w‘ ‘ml!- Lears wimp Boston in Overdraft 3202,0493; (A) Admlnlvmilun I-M ‘ ' u. Two fengeg m... 1.0m, Out. m was two kea amid o1 swam Olrp those manna (B) sinking Yimd Pro- Supervision $13,464.19 N“ “m”! % u 109M094 he bruwny Irish gelding ot nu, Horton smith or Oak Park. m. the finals-u sn-ong Boston vision 11mm“ (B) Maintennaoo or msh- 1941M“ - - gen érgggh ‘arid rnunltli d)‘; 1:110 samiiny snelad (é wlreim sulphur mm, I, humour; m chug ooh ..__.____ways .. l n“, s n oceyueilrsi ,W. ., adingmon- lairedohLeafa er '“"”°'” ngilgesmmm“ n mas g“ 3m °* mnkm" whrromlpm the stands w; aoooeoo eglvlhixafnnur oiranlmeuéessa oheimi1 $11k?!‘ :1; xli-imojnkwezfit b? u: I . hi’) fl i 6W 0 2.. PUnLw wan-An; (D) Maintenance o! lller- (iaffkntofmcg: 24530530 gs E118 (‘Nwd of W000 were mass- slipped to e mediocre (mirth-round hockey championship chosen-III (A) pubm; 11mm Q 193g“; ties 28,891.43 old A“ Pm; “ma; grg yard atrefgl for ttfhe 75 and fell back into a tie for suggestod the bet...a.nd I (B) Fglggnwgod (u) Whgyvea c.0131): 59m” We 3M twoeigpotsafli} coiigrlififflg; third plaoe vv-iui Dick Men, or ruled him right on amok... m; min-mm “us”, (r) Bushing not 1,420. m, cm m“ om’ - . Hm in m; emerald 5g,“ on wow‘ oilidego. who lucked out a 1o u‘ (c) Grants to Hospiitsil 10.2mm m-“l-w Oveirdratt Blind Pensions 201424 mm and A. Alder in Primrose on Em‘ m“ m‘ “m” “W muff been (D) Child weird" mm m, Om Bank o, cm_ ' ' Mndlflcffgl; worm,“ mined s11 m. ———-——— H111 11W) Bflekaml l, “u... t?) %‘3.£‘° 11$“ mm‘ I Refunds of Revenue soaosss m“ ‘Emmy’ °°“' nnistsylllfstiflfitilll “mill and s“ Heated Debate In $211)“ loflclfawghw 0:81"!!! t ~ - m w n. . - . cw“ “i°"3% lilies. we - 1.50m Mvtmm- s.»- ”°"°°°"°° ...l°.:.m....i.ea.§§*v .. ...~ N- S» Leglslaivre smite? ~ 14 _ _____ (n) Granite to Institu- '4 m roams-i woflnflhgm, fifrtfiindiflmofifi," HAIJIFAX. mien u-(om- vg fim fi h‘ “m! 39-49999 u‘ ‘ Duo Provincial Bank- and never left the muse ain doubt N0" 5W5“ 1433M" ma” ' Hill as a Ranger at a (I) Om" PM“ Wm!" (A) “mm” °°““°u" Fisherman's man Aioct. oi ocean A year ago he finished third u; passed s rwiuiflw the Winnipeg hockey school a few Grunfo emu (B) éegigm $19910“ _'_ the Battleship and Royal Danieli. minister tgfbfisheries grant: m“ —--—-— .._i__i__-__ lic noes cam or er NW _____ mo.» he» i ~=1~ ,,,,,,, Duo o... t... - v»- v "m risen in- e e» mm... w» w“ t e m s. enncanou <0) Realm and 14M °"‘ “M” ."_°"'.“°'"_ Wrought-iron obit. are much Nova Smtia boob and line fisiher- Qfiggf... u, .-,,,s‘1,“§'°;.,.~ u, (A) P. w. c. arid Normal We Olflw 8.91MB 139m” used. wi-oiehi. iron is B150 used men cannot furnish an adequate Rgxlgem only five of nu a. col - Hzassso (D) Petisions to nubile m,‘ “mum, a M ' ' for wail decoration. A great spray surely of “liable dlscoveries...he picked Alex sni- (B) Inlpeotionofschools iooooiio Servant! 1500.00 ofvine leaves painted in the plnky- The resolution. moved by hizh- “m. or Winnipeg who has bear. Dec 31 193B evoeaouli. (c) Manual Truininq OIBIB mm (E) Miwailahww 6mm 2.90000 m, gimme, s; ' ' mauve shade u beautiful. placed ways number A- S- Mach-liven doing right well for himself, Mob (n) P. n. r. Libraries 16,082.05 <1’) Wweiiwwiu Er- m, ,1 m, 5mm” against a. cream-painted wall. as an amendment to QOMWBMW and Nell Oolvllle and a couple or “who; "wit". .... . “m” “m” ' ' ' ' ‘ “m” "to." = W or. h:“il.§:'°.i..“n.%‘l.':r*e..n" will is. ~ _ -———— . camen s " was a. (F) gmi-agngqloriq 5; -' 1 118,881.33 w m uwumuk‘ .yBowla ofgorenassed ane- 1119M and W-Tua/mwt "he n9“! m‘ "doing swell this series. but n1 1mm, 311mm‘ weal. onnmanr "Mi-Mai mones vvi pick up the two colours. early action to terminate steam gem 123KB Shi-bicky and the voi- (oTsohoidi-ahips a4o.oo mwnrrorrnm —- — 01.974.368.09 The new imliamed porcelain 0m- mfit gfteiirlgrotwe. curled on I villea". .. (1-1) M“); mumtion 1314113 aments are amusinlz. The pore-slain Th a ngme t- med mum _ —-—— (y) 3mm U ' _ 335m CAPITAL EXPENDITURES is hand-painted in the rough state e "19 n P Its real money. the/t H (J) Impoowr of aunt l in which it emerges from its first the hmixsi denim? 05 11319 “QW- figures oimmsking wi lgpugug wogxg ThPCC IHJUICd baking. Moat attractive are the 145ml mmbe" 551181“ with "l" his fists this year...here‘s what Um“! 500m ' o iition leader wihen he d . - (K) 5mm] guppiy “m. AND HIGHWAYS I T k t Victorian wipe. up?“ u ed he‘! Piflhhlfl! 0H 111011318 Bl). _ (A) mam‘ of w, ' "350 ll an er a5 “mpg (M; hue surged in go i316 Bil-me 01d i)?! n66 WM m’; ainst Ernie Roderick in - m’ hum” (s) Permanent l’; 3794068 —-—- om- can be invested with a sinrt- ggvnbggnfitiggggggnmgdmgg gfg§dlio lrund. #:6050880: MBl1"i$i'/t1% Amber: , " uuwvonx.mmha4-( -lirur be b li, bk m» -iesflm v Bow w. Olrneflid nndbvv-”°°m'” $3)» ivtiiloifilmgulim 5mm“ With a roar heard five miles ii- each ‘gr. ibmiitlynw yli.§“§in'i‘§.n $5.11 gigriufge efignrgio" gig; (1,133 in minim. 8100.000; 11811111151; roux, mm‘ m“ {mun tghulwwwn 33,590.48 magi: ‘when tluizh new: of the inner side of el 311$ A1189 es. $40. '--" “m” “W” Emmi-m‘ phuildino Con). in .__'_______._ - --—-—~— weight champ. calls Henry a ‘ not commas Tginmrslde _ 86.74406 mum, seriously injuring mm Emma "HAL, RAILWAY nuvuimu mm)» f)" m.) mo... bu,“ h“. 4. summed-run n Infirmary 8,851.40 1b shi burst into flames im- '-——' MONTREAL, Mar. B-‘lhogrouu “wwhfi “ ‘ w" ' m, or mane: o (o) Garage-Now nmla- medigtoly 2m: tho explosion which belfgwhfgojifliigghflfgegffiifig h}: revenues of the all-inclusive oan- 1m 5,.¥,;‘,',““§{,,?“.,,,$. 1.3,?) (A) ‘submit Court e lemon) 11.9011 l"! "i=1 “Wm”? "",h°'“,‘,"§ m), mm were first opened in W") "fltimi Rflflwm mm rholnpsbn wmt to scout the can- (B) County Court! 8,001.15 (H) Power Machine y 18,142.13 the ition o! gasesin e o for the week ending March 21. w)“ Amateur Hockey Pkwy“. of the .600 ton tanker Calcutta. but Delhi and Bombay m Magistrate!‘ Courts ' 4mm ) Mflceoue 2,102.2; Bum m mm m h; mo m, m mm w M” the“. mm 1939 were $3902.44) compared wi Mill! of his Ne: York Amerlnu-nl (D) n. o, M. p, _ "30 , (J) Savage Harbor Road 3,160.35 “n”: “find in N“ Y0“ “m” $3,215,808 for the corresponding u‘, 11mm; soughmguq (E) 0001s 18.1%.” i!) Oflfllillfl BNMWUI‘! 1.54037 u; gmm pm “mm; n!" m“. NT a h 901104’! 0f 193B. a decrease o! I13.‘ can and his wife, along with Joe (r) Coroners’ mquam aim: ina a we» o: on. Most o1 the on (APl-Doukhohors and n: ween of ""1 ""- m" "w" "1 M" $185M??? had fo tho blast their in! up vlenb of Florida sunshine . beenremovedbero mourniruzfor terV n. , 00,011.00 occurred. late leader. herd tomorrow with a and the expected proclamation or new that the Aa are out of the , ll. Relief Ant loaf-hm . final memorial service at his a new leader. playoffs... i f