N OVlBMBER 30. 193i

YES TERDA Y’S S TO CK A

1-—

Tllelzicgtrzal Stociange

(Spccllf to Johnston A Ward)

I‘;

THE CHAREQTTET‘

The Montreal Curb Market

_~_..-__.

(Special to Johnston k Ward)

{m

Sidelights

in

(Canadian Press) I

)WN _GUARD_IAN

760/1) Q

("um 4., Johnston e “'arl1)_ Starks Qlw-nilllllhihvlvilfil Qpo|l|lilgil|i.u\\'Last .\iCli Allitlbi .. .. d o Ail‘ lleduc 041,4, aw, 04 0i -1 livil Telephone A2131,’ 121M193 1-3 Alleg Corp 2% — Brazilian ... 4 . 13- 13%—% t.‘ ( My .. 7% M w» -- a n“ ‘t _ loll: C"... a " |‘lln (‘t-meat . .. 6% —1‘/-’s (‘an (‘elu Pfd .. 77% — V4 (‘all Gypsuur. .. 536i ~i- ‘all (‘an ind Aico .. 2 —- ‘A i‘an Pow Pap .. 72V 7 — (‘an Steam .. . . '+ y. c rul-glusmt . 10 10% 15% —1 lColls lael .. +104 lirydt-n Paper .. 3 1 — 1,1; Int Nickel .. 10% . - 1m. Massey liarrls . ./ L "+13, Ric-Front ... ,3 lambs/gel ~ 3% M '-’* W: iii’.".£..‘12i'.‘".: ': i? ggfgc“ “I w m“ w m _ I,‘ Steel of‘ Canu a . 2g ‘ " lVln Eeo .. Byers .. .. l4, 131% 1f 14 “'19 _ '5'" A M " l" u u I lloxrarlan, Quin, Nov. zo-lny tin- ‘fmt 9H1" “u. m". my 16y __ (filnadian I‘ress)—-'i‘ilo downward drift. l; U,“ A“ “if 13,-‘ 13,‘? 13?‘ + y‘ of stocks was cilerkeil on Saturday k “"1"” 1'45.‘ ’“ “ "__ when, after a quiet and featureless Egfilrlnasco Wig _ sessiloa of‘ thorstorlk llXshlllnflP, an‘ f‘ ' ' ,.,' . - . cqla numlcr o galls an osscs a ‘.l""‘_”.n"l° n“ 11% of‘a minor nature. were shown. I (Jhuu. l!” ‘ _ 3,; 34,, 35 __1 Trading volume continued to remain ‘P1 2m!’ ' w“ 19;.‘ 19,, _ 9/ at a minimum with 3,420 shares sold '1“ G P!“ - m." ‘W’? 05.§‘_ l; against 3,4211 on the preceding Sutur- (‘iilifl (ins . 45,?‘ ig.,/"__ ,5‘ day and 8,504 on tilo corresponding ‘Pr? 1m ‘ ‘ " _ day of last year. The slow but con- "'“ “gm ‘ _ iinund downward movement of the “ml? 1"“ " _ 5/ wet-k had brought the prices of prac- __ ' tlcsliy all issues to their October lows. _ completely cutting off the advances _ scored during the spurt in wheat and __ 5, sliver. During the week losses from ,} _ ‘r a fraction to fire points were sustain~ " _ {i ad bv practically-every stock on the " lloar . _ , constructive feature of the market __ I /‘ was the willingness of holllnrs to re- ‘ n tain their stocks in fuco of the weak- : “i ncss. Sales volume was at an excep- __ s‘ tinnaliv low chb and there was no _1% sign of any important selling pressure. y‘ H pi-iiitlllrdfiyh; trailing‘ saw “Canadian ' " _ lea in ac v ty wit I 1055 10% " 3411800 cshanrellvnzlhanging hands The ""7"" Mil" 2531' _ price was iii nil morning. off from léiél-lfiiilu" ‘ill. ll? ‘ill 96151352 “Jldily” °'.".i."'ul'§'““l'.“' h“ film" "' L"! 9°] 52% g2; 51% 2153-11‘ l-lllalie yofwiyg. BIBIlllil!lIre;'Il'C°tl0Il-:0l3 ¥4D‘QVR'IBIIIO . gigs W. : ear-dividend at 10%, up l4 while Can- ‘P l?‘ -- '12"? _ ada Cement firmed 54 to 7. Simon Pre- .iath l} .- ‘in ‘ ferred. ell-dividend. advanced 2 17"" “ "d ~ m 1° 7' M‘ " 54 points on a single sale of "6 shares .\'llsh m ..|2i71,§ 11% 107i. 1(i%—- is ' ‘ . ' ‘ ' a n- . 41 — §i'.'i‘.i‘.'.'.u°“.'.“i‘"..“ 2‘.-"".i‘l°' i.“ m‘ “' gs: g gm 20% 20% 2 Gig/z Seven fllfilllllnlifl. dollars Trill; of Nay can? ‘w’; 31% 28% 2s“ 2% hélnddsl chanlged ‘hands with no out- ~ - » ' s o _ N A!“ 5° 3'15 34% 33% 34 _ '55 "Flue nlgatililncai geagilgllalan campaign Ilzack Pill‘? .. 4A; in‘ H“ n,’ -' ‘b rapidly neared its end. lip to Friday P35“ RMI~ M_~ "a m, guy" ‘é alight title laatdlnnggvillle rail for Can- ~-- ~- --. ~l—'- a ns a g s ur-w gag; gnu; 381/. - a gbvernment l? ii 05.1.’??? field-l lilfl’ I111 C0 J14 Jiu d)‘; 47/1- resulted in subscriptions of 3121.000.- Rudlv (‘v -. 8%. 8% 7.5 7% —1 00o out of the $150,000,000 bond issue noel]? h] ... 1'1’ 2% 2 2 -' l‘ offellI-ed.‘ Saturday's figures were not t» — sva a. e. Smlltzfglici 35% 35% 357s ~52 "Sltel-Ililég ‘exchange closed at 84.0742. . . .. , — ll tel l ta es unds closed at a prem- § Pacific . 3i" 3'.’ 8i ~11 i f 151 _ soulll null 10v: 101,; 01,0 0y.- ai “m °- l‘ p“ w" S Brands .. 14% 14% l-t- 14 ~11. G Eiec .. 33 8-’! 31% 31% —1'~ii S O .ofNJ 32 32 31% 31M- $5 Tbermoid . 21,4 _ ' E h u... p. 1. 17% 16% mag-u. Foreign xc ange Tex I‘ Rlll . 2d — Tim l‘! B .. 20V, 201.1; 201,1 20V;- M; i; i~.".“.i“ ' 2i i?“ “i” W?‘ c c . l —-» ijnlt Mr 13% 1R". 13% 18% —— l: .\i().\"i‘REAl’., Que, Nov. 20—-(Py the I "it ("'9 -- "'4 11"- 11 “VI + ‘b (‘llnllllian Prcssk-British and 10H!!!" n n n“? " 2H4 2H4‘ 2W5 2175- exchange in relation to tho Canadian 77 s I 519° 97% '33 37% 27% —1% ll r complied ll the Royal Bank d lia , nl . Y I“, In , M of Canada, elm-loll yesterday as follows: u s “In 535i: "l Argentina, peso, 0 I80. 0 ‘ Austrlila ' ' 4 4 35-’: 3%“ Austrln, " . “pr 1""! ~ "it ' '—- llelgiilnl, ilelgn, 0.100s. “i-‘B Uillfi" 51% 51V; 59% fiiWiih-lifi Brazil, luiiruis, 0.0720. “jest A B 1114 111/. 14w. 11 1'— Bulgaria. lcv. not quoted. “est Eiec . 33% 34% 321,24 iizllgi-liyf. china, llong Kong dollars. 0.2922. _—— PZBISlIIIRlKIVILKlU, 050,232, 0.0343. q li-lnl rk rone .'... . Fllliliiililtl, ylliilllilfli, 0.0230. l-‘rallvo, frilllc, 0.0151. Geflilllll)’, rciscllnlnrk, 0211?. Great Britain pound, 4.07 ... ' (irrccc, tirachlna, 0.0145. estefn/Ranch Holland, florin. 0.4030. ‘ llullgary, pengg.‘ not quoted. LBTl-[BRIDGE Alta Nov 2'1 - hill?) lllgfeb 00054- ' - ' " ' Y." 1'. Emulating the Prince o! Wales, a ._-,‘;}§gg;,,$§'f-,,‘},,',Z,f 0.023,,‘ deal has just been concluded whcre- uzifllfiiglaeiifsllflig-_ 3-7039- by Hon. lRobert Weir, Minister of pound,’ 5101i, 0,1305, i l 0.00 B. "lgrlcmturm “mm” °w“°“ "l "m ggllxtlanllfllliflifulloiillll? 5.0200. Mongeon Ranch south of Plncher ipniln, liirflifi, (lion-uh Creek, in the southern Alberta ioot- §,§‘,',z°,_';’,a"5f’"f;nn; ofgflm hills. The ranch of one and a halt prllxgitplg States. dollar. 15% per tent sections is well-known 11f the Wuth- saw roux. n. Y.. m". maul-urn exchange irregular. Great Britain in

western Alberta. cattle country and has a beautiful setting at; the foot of the Rockies within 20 miles of the entrance to Waterton National Park. '

udoilars, others in cents: Great Britain 3-5351- Franco 3.00 15-10.

aiy 5.10%. Belgium 13.87. Germany 23.60. Canada 80.75.

ii‘- Dominion

5-Year 5% Bonds Denominations

IO-Year 5% Bonds

r ISSUE / 5-Year Bonds-WM IO-Year Bonds—‘"-99

ties, and s all be

1931 National Service Loan

Denominations $500, $1,000

Interest ‘payable half yearly, May 15 and November 15, Canada of any Chartered Bank.

We invite aiplications for these securi- . copies of the ofiicial circular upon request.

Royal Securities Corporation Llfnlted

‘ , Riley Building, Charlottetown Telephone 8Z2 N-lntresi Toronto Halifax Saintlohrl Quebec Ottawa ."‘“"“ 'li....l’.”‘°s'l2'.'3'.l...5l,"l5"s'4. lac; “l....¢....“"°'"."il‘..¢.'“"“‘ u...

of Canada

, due Nov. 15, 1936 sioo, a500, $1,000

, due Nov. l5, 1941

at any branch in

PRICE: -

\ and accrued interest and accrued interest

pleased to supply

PAGE NINE

l Montreal Market Prcozizce Market

(Canadian 'l'rul) hi0.\"i‘ill1).\i., Qua. Nov. 20-—-llutter Drives advanced while cheese and pill.’ illllltlltil-lls din-lined allil piltaifl Ilfii"‘-“

ion, car lots 12.00; cheese, Ontario .0oz.lv.l-1',; viii-vie, um-ln-i- . llnil-r, ho. i finest .'.‘

Ira-sh spvrillla lil i-artilll

fresh r~.\tl':ls ill various

fresh firsia ill cartons

storage extras la cartons storage firsts ill cartons , strlrllgl

UO TA TION

i "

1.

(By John L. i

Flnr

NEW Yfllilu. .‘=ii)l‘k nlarilct

lRKET GOSSIP I

. a Ohio. Bum l" .""“.A::°:)l“'d Pr." 13;‘. llllltéfifillify Central and Union: Yr i... "ll-The iwoifie were off rouiili! 1 1° 2 Am‘ unable to ‘enlarge i'l'.i(‘llll Telephone rcltlillii"! i‘ mmlemm

8

Conversion

. . . -- ‘ Electric and (lellorai .\io- hl-ili uncilnnircd on tlw l""‘d"“° "lill Jill. . iz-llln ‘the illliill ls of the Ottubir u» lass, (rPiiLWill r mm, ymlnn. gm k y , A A _ ' ‘ _ v ‘. _ ,_ N _ , ., , . t, l r were about snarl. ii_ ~'_ Milli"? .. .. orlllllnlbhn owlr “t liIONTRPIAlZ. Que. Nov. Qli-Snillr-l lillzfznlgliifllg"?syf_‘rpo"hzfifirlu“ m‘ "'0 “0 ‘riTlfi-kisllfiilliltiittvili‘glsilllftt of steadiness all llilsruii. Case and AlliPflPflnilflllllf" t- Brltluh A... (m _ my; day's brief messiah 0i‘ "i111"!!! 0" lb‘! “ML; ma, r‘ f"?! Mnm‘ “m; o“! _____}_____ ,' the ‘firs, 1...,“- whc" it appeared 1'0 ii llnulo Hlnfl" Y""‘i'""“' F“ "m" (‘an Willi,- ,, 1 local exchange will a coulllletcly fro‘ 0 1' g ' I " ,. ., l 11.1 5ll"!‘.(l ill the illiter Rloineatuln was added to the dec m! m! f, ' h h M ‘H, and potato quotations were stem y. l nlltfltl‘, ile - Lb _ V I “we, n mum,“ 1n n“; °'i1-$c-'| 7 tureless affair. WI! l 0 N" "i |.~ , 1 nstl-llrizedl - »1( r ll session under the dispiril ily llllrll tlst . I . W ii Street lilo '"'“"‘"' t"“'"9h’p3 no‘ p " 0 w - ‘ ii i area would begin H!!! n” smn" -- "lél ‘hwvmvnrd flu“ in a lump,- l" “r1018 w“ up n quarter hg influence of tho rails alld the lnar loungdm ll H Impem“ n“ - -- 11%| “M”! mtmence on market sommwm’ of a H»... 1t "“ in’ "‘"/ cents a pound. kvt finished from fractions to three week at 32 per rent of capllc y, s Illlli 'i‘ullari-o . Rm ’l‘i.ul broad advance in values tilat "Wk ’i‘o retailers sblidsnllt‘ 23 to 24 cents h paints llif. Sales totullull 0.181000. Iirflii "f 5-’ 1mm" "m? w!” flick an lat Petroleum _ 1111,] | pillre in October Ilsa now ilel-u ltilii, "m! pr-mt‘ "t n‘ ‘o 25 Mn“ n MUM | Th“ ‘\~_,,,,.l,|l,..| l-r.-ss-.\‘t:llll|:lni Stllt- n! Ii from last uw-ks liifihigP-t d lnt Vtiiltios I; 21/_| | nali surrounding conditions are not of Wrp ‘Hml-‘mvnu-l Receipts m“ “wk Imp’; F108,“: “v,,,,,3,. f... no stacks (‘auiillt-nlal (‘liffltlifilifl were slca y Moss Minna 23%| l | a nature to encourage a collslrllcth-r- WW0 aamwuixeé ‘Qua 73y, m- 23 paints above the Oc- Gcrlnall ularks lillpflllPil sllcht you: oom- Ilm-"nd" " """°ml5-1°'15‘°°‘15-1° ‘um-Kat “mod m m” presenttumefi|kli' ml l'h<- (‘llfifillfi- market. Ontario do . loin-r 5 iloltulll. Transactions totalled llle lltrellzthnof fIJl‘l‘"lI1‘len{Sl'o;t:d ‘m, .ythai 14h" "m -- “m/Jl | i “on” from “Ind” and ma“! n,‘ “ ' e ciiued an elrhtb of a cent at 0% t- 938000 shares. cernlug crcd repn) r E Ill . - Ii ' Silerrltt .. .. . fill I Pointing to some slight b tier ent 91' PM,“ wLhlle Quebec cheese wa ‘ new lork Central was bombarded prospect lh t balances remaining a tel I pm TMk ""11"" - 5415i 1 l M“ “m”! "5 y“ ‘mdmlgge!’ “y; stltadv at 01/; to 0% cents a prlulm ‘ ‘with selling orders which hammered February 29 would be renewed. "o" v I 1 < . ‘I n1’ ' . ' ii uiki-r. lllranl 3a,] ilrikglltkllhlllli" "9 mpm" m" iioctllpifl for the week were 11.015 lma j l it doll-amt’? ltzgUfilg" Kin]. ‘it’? WHAT n": STOCK MARKET mm ca. H orn ‘Ln l K Ivan “Dim” to m"; ____ om” farm" “mt may he "Emma tfiiflvfit Prices of fresh 0R5! ho’. ' hit-e approx lllldltlb ’ ‘M. A l a in“ f’) ‘be’ m. . . as Ffliiiflltijillllflfi tohiillllllthlizltliy llfliflliéillli fiffllqgbtlggf-raslllt b4efiingeniiuuottlelltl| P1518}? LONDON, NOV. 2'1. (Carl ditm rnihlliét ‘1"-:'4“i"z;ll‘ig‘vpst Milton“; fimnimr "t! "éivqlnra: H 3:‘; 4:]: Gov‘ tl l ex el fl\\".'ii'( lo " ' , _ \ ' . g v t , l or n e0 lle - l’ r Mlnlng zltw-utl-Ill?» midi... at the prcsrn lime ififlifitwcewxra" JL1“::I-|g:f‘°'2§fr1z5fiféh:: Pres Cable) stepping to me am gwrmwlflllcth '“,',::',1':lcdu,t‘ 42'..'-‘l‘l:.,rlm1§',:.. Qililifill; unchanged -- 1"“ 1a -oposai helm“ m” "nsenlm Gemm“ mu‘ qllotrd at ["1 cents firsIts at ‘24 tn 25 o! the British ‘Mme!’ the Govern‘ [ladle dipped ll point to a new liliniln-iTotal issue; traded 000 t v0 p" IIUOII. and the xrvwlnlriy lento lwl- Nm, "m, "m,onda'nt n1 n, 00 m". mm, mtends a ‘ in a quota to ,__ _ ______ __ _,. "n" .0! we mllwnytun "a; c|o':,";]p"\." a Ill-IZPII. Quotations to ‘rctaile-lm uvrl- ppy g “_ "“fheaf—'gf8y:vér_q““ l1‘ Per Illdmdugll-lnnhillllll: hrllrulrléuulu“ uplul "m "n" 10st Week's receipts wtnllv-I h°m°'g"°“’“ when’ s“ John G h been lctureo , (Canadian Primal {llgnfigiil renyssuriul: feature is alquitc flmffu“ mink" w“ “nrhnnzm! mfllll‘, Minister of Agriculture, gn- throughout the 601111111’ 5W6 [hi g muflb - u .

'1‘0ltO\"i‘O out \'uv "U—(\liliii"B "nlnphitamlllllte llellilvllllllulcel-uqtlllflllulq’; ‘illutvltloiilinliftr s0 Hound ha: helm: 8F- "mlnffld i" the 3W5" °i Cmnmms- advuatmg a quot“ system by w)“ OTTAWA. Ont. Nvv- 27- ‘Bi’ till 0M8! close); " ' _ ' film-Ml‘... l‘ all: increase ill aellln lrts- '“ ‘*5 ““"'-" 7"’ Q"“"‘° “"‘"“"' n" "' A5 another Iank in the admillistra- a certain Vifi-‘cntage °l Mme grown ' ess ~—R.etirement from ' qnloq stock I“ ‘Hovdq .9 ""7 ‘ not g I .'l.’i cents for Quebec green ulnulltailla p dd d “horny Canaan“ P!‘ ) 5 W)" ‘25ll0'.\~-lll0 .. .. .llg'.l':l"l".lll"/.l In". uua nr. to m .00"; for xl-w nl..u.ua.-l= tlolrs new agrarian lviicy, Prime swirl would be a e “mp t m, Government service of O. l m and

1.1;‘, " 11")“; L03 One favorable fcatllraavhlch suagostll gfillllnllllltllllalltalllllltwileyrllllnnpllllnkl, Minister Rrnlsay MacDonald Silid a t0 eVCTY bushel 0f foreign Whih Flnnjg, Dinwibl‘ 0f the Northweal o! the

iollllillllrrazuu ,_ j _~ __ llnidlllsencnlalllll-lflrlltengoélidniil; nonlnvgrli, \\'<‘l'i‘ urn t.» 1o cents. financial resolution, authorizing clls- for milling ltlilriimfie: ‘culture Sam Territories branch o! the D9011???‘ m, ‘p.

'. llurt of the public. wilich despite tin‘ nllscrlnnaunoos i°m$ duties ‘m "Frlcumlml Pm‘ The Nnms er! ob gr d flecuvelment of Interior and M55“ L‘ T s lear-

2.‘l00,'\".:lllusa tots: i052; of, the wggivubcalgg: ‘is 51's“. “OYTREAY Q N o" B H ducts. would be introduced in the the quill“ Wm“! e ma‘ ° e Bur-wash, prominent Arctic explor- of u“

W | ‘ l l 1, ‘B, . u. — ii P_ . _ mQaYQfia,’ river! to theunrrauonod‘ (‘uulldiall lynsterladflo. 3 (g1: oats. Canv- I House next Monday. l0 next Year’; GNP. He added 3380-! a and investigator for the‘ D9. iuunhlvlluulul-lu ffézhtflinz:Qglhxxprtigt"hi: enzyme": aluuqgrlvgitlll-rn nnrlérilngoivgttqa- fiifqflr-Nftz» Resulfng from the anti-dumping the governmenthad deoidgd toin partmmh Wm m“ pm, sham, r c°m_

'7?‘ ilrill‘. .. . - ‘ - ' “ _.‘ . _ ' - ‘ _' ‘ _ {,0 uee m- _

5§gill:~‘|li>l_\"u|l llllhkvlcgll“: ggiilgnlrlfintpilffihnvlg" lrllriz-Llknalnflgxg} ,-‘l‘.'.'lig‘.flfi'oillel‘. irgisiatlon llillitlll Elflplrlfidt tariffs a fllzlguczricmrizigrilon agent!” a? Both omcers, it was imrned allies; l “w;

f.‘ lr- inllyn -- ' ' ‘ " ' ' .. ‘ _ ‘ i st el-t l .d i - D 5 3 ' i D oem

3,._{H|,,,,,,,,_,L., IIPHQ!‘ in sentinlant, provtitllng as: it cats, algal»: v .-:_4o-.1...o_ ‘any, “up. 81in c an manu ac lrr m Hem of cultural produce" by ly today, will let re on e Brlum‘

all‘. 2.0210.‘":.r:.::l“:...lll..".420 1"“..?.'..;i.".‘.‘1..“damfTSI 1- PM Bus“ ‘ante W” be" ' , ‘j H, H, =1 not ..... u.

';‘%§§§f,‘ff“},,,',,', ilo overdone. 00 lbs. 2.00: hay no. 2, per BKHQHUB m? 50319 “m? for 9' 771993‘ means o e ca‘ made a

l;:l:'".'l:...-.~_-;; ~~ ~ ~- —— n w-

Ziililhicilltyre .. ...|

1000M i i ... ... "

300 lilllll-cnlzarp .. .. friend’ iolnollur-null .. d. "bui-

ILDOM ss . .. ... ,

MONO and! .. ' l“ m“

zotoogl Colon}; .

2 ‘Ilaa Antono

IEfiUlShEIIIIC m“ t°

iiimlfiiscoe .. .. .. 5-

fliiiflfiiadacona .. .. as p0

200Sylvanits .. "X1 °°"' 2000T0shota

8SOTeck Hughes .. 5 h" by

HOOIJMCGG Kiri: ...

500 "pond _

2700Wright nul- swkes

Sales missing. ‘ q Offs l0

UNLISTED ‘ Fund‘

2 items

1700IAi1ana .. .. .. oil/pm lm ' w h lzfinglg iulzflzllul-l . .. .10 {.15 1.1a a "ti": . 102$ 10._:'l 10.25 1]

20o (‘al Edm .. .40 [.40 ‘l .40 , "m" ‘v

IQOOEIdnTIIIIO .. . .93 ‘.90 :1]?

33511 l8 Bil . 2.9.’ ‘$.91 ‘liil ‘ _

a0 w» on j .. 11.001 11.00! 11.00 i? sup" 140 Nickel .. .. 1000i‘ loan; 10.00 0r (ll-eat Sllii Pet ... . 1l.'0 11.70 li.."0 _

1000 K-Hiiillzll .. .000 .00’ 00' 5 5mm

4500Nordon ... . .17 .17 .17 ’ L50 p91‘

000 Pend Ora .. . .88 .83 .83 _ T

ftiii10iPon Pete .. . .02',1| .n21,4| .02“ "l?" 1'

l002|Veatures .48 [.46 1.40 I

gum; 7e among

u ' I i -

liiiflllinhjo .. me Br

0000mm: .. .. e Cham- ilitoiitiiilrolvniee . l I I I '

2.500191‘!!! Kirk

Rl00iDom Exp] - Zlimifirozclie u n‘ lame "l" ~ -

l lago . . e v dune... HE National Service Loan 1s a great national cHort by a . y Canadians for Canadians. You can do your, part by 1 z me G ' E ° ' ' ' - ilconard m!" xPQTtS buying National Service Loan Bonds. By doing so you will . , a e ' I 2 be serving Canada and obtaining for yourself a safe invest luring: 4

Wi."i\'ll‘l=1i‘.. n“... Nov. 20—(B_v the ' ' ‘ I (‘illladlnll Pressl-Whcat traders ndnllt- 3. n Wfliyh ed In “uni; and dsee‘ ‘attitude l“ the \ulay and gran pt are o ay. s a l-osu le , a Sullivan‘ l arkct '0 si w ifnir all prior-s 1 and cgflgtfufitlve £10,... ,,,:‘l‘,_,,‘.‘,,,’},? ;‘.,.,..“?,, .4 glmfi... ,,, .1, The proceeds of the Loan are to be the most senslb c h.

h gher t an Fr in_v's inal aures. - ' '

“Novclmher 95.... a 5m, unulu a. used to promote the economic wel- use to which a Canadian can put 1S . Ryan. i eceln ler at 1% to 51M. was l,’ owcr. _ _ , ' B n8.

Sirlivflai: 02 was 1,4. um...- lliu July fam ofthe DQmlfl10fl-—Wl’llCh means money today. And as an investment, zckeyrion

on c unchanged to 3g higher. ‘

ram was a littlmb ttcr export - u an g r131 attrac- h. trade worked during ‘lfiillhlly night alld yOll 311d your friends and all YOU!‘ thc Bonds OE-cr Yo q d ygcgfm soltiiuont app ed t b lno f ivllli- . ' - ' 1y.‘ Prices opeellierd £01,303...- llllt rsuffi- fgllQw-cflflfldlaflS. tlon- TIN)’ are the safest and’ soun est cient recovery was orthcoming to leave . - - the mall-hes fracitirlllaliy iletter at the Of Canadian SCCUfltl¢$"'b3-ckcd at, Galiimi ease. ra era nd catcd a desire to . . l . . . 1 uulnuxuy from it‘... utuuuyhluuulll‘... hst" There are already indications o ct the whole wealth and integrity of the 2 aw c ng opera nns o e r nan , . .1502":.l"ll..:r.:l:":':r.n.r:";::..ll:% W’ ‘ms “hnd- T“ ‘“°°°” °‘ ‘if Dominion. They can u. .01.: for cash _

o liiay and July. ' ' ' . ' _ h bore

Foreign news was mixed. n was re- Loan and its expenditure in Cana a at any time and at the Prcscnt Pam s e parted that Germany had lowered the , . H f _ _ , Ohefilul‘ tariff‘ on llt\,lil'l:_\' liliil nothing ‘twill: nmn- Will IIIIdOUbtCdIY qlllCkCll thC OWO they W111 Ptovldc an laconic of ovg]; even ‘has!

Dill‘ W I cgarl fl WiFfl HI’ l.

n ti 0m» lad r h t 101'! ' ' ‘ "" ' ewsssui- W211} '.'.’:l.l..'u:r».'Illwfuli’? uu.l"§.§' on Canadian business and glve fiilwwcd five per cent. an unusually high rye, on a nul bar ay. - . ' '

Cash wileat. lu llzrht trade, closed ii confidence to Canadian trade and mmrn for an investment of this kind. m“... was fraction higher while coarse grain‘fu- “ed w lures showed fail- gains at the close. commerce _ h ak .n a one

' ' C III 1 t, ll he! cm“ i h ~ sell-c fins c ancc "01.: P ' “t. ufreguentiv ' "F" W’- "Vvifl From this aspect alone, the purchase national effort-wit every mv s. “,0; Doc. 000.; liiay of a National Service Loan Bond is mcnt advantflgi? t0 Y°‘1l'5°1f' S htliting: m... allots; Dec. 3053B; ‘lmic e le‘s cm - z '93 casn cLosI l i S c d o and n. Wheat Yo. 1 hard 011,4; no. ‘l nor. n ‘amsay’ as- . ; no. L’ l-ov. .'.i»":!.; no. .'i llorkhléfiésao. n. REV- Mr- 4 40; an. T. »!iI/; nu. ii 40V; ee . 1 _ _ ‘",‘,"“, “Q "‘.",l' '.',',"-,gi,"i7,,,, ., ,- Q. Send in your order now. Any branch in Canada of any chartered bank or any recog- jieeigoii’: ns~-.u.‘.‘. .. . . _ . - f . m“ ,1" "' ' """' "§"’§.§."°' 1 t": 2°‘ mz" ed dealer will supply detailed information and the necessary application forms. no. 2 o I'll-ii’; m. .. /; trac 3 . "Dari m lflliilifl grades“: 2 ray .55.]: _ six of her . ..row ex.. .. . .._. Other grill -= w. a c. w. any: no. - will Irvine c a uh 51a. uokllagx u‘. sail/fin». 0 ICE 5 YCQI‘ 5% BOfldS, and accrued interest rmedy‘ Pr“ . V. 5;; true . z . ' retest zierson. H61‘ ~ crllcaoo YCat 5% Bonds, md ‘ccmed m ' mm" Km